Lineage for d2oxna_ (2oxn A:)

  1. Root: SCOPe 2.05
  2. 1815291Class c: Alpha and beta proteins (a/b) [51349] (148 folds)
  3. 1815292Fold c.1: TIM beta/alpha-barrel [51350] (33 superfamilies)
    contains parallel beta-sheet barrel, closed; n=8, S=8; strand order 12345678
    the first seven superfamilies have similar phosphate-binding sites
  4. 1818156Superfamily c.1.8: (Trans)glycosidases [51445] (15 families) (S)
  5. 1820068Family c.1.8.7: NagZ-like [51553] (4 proteins)
    Pfam PF00933; Glycosyl hydrolase family 3 domain
    Some members have reversed beta strand compared to other members of fold
  6. 1820100Protein Beta-hexosaminidase NagZ [117370] (1 species)
  7. 1820101Species Vibrio cholerae [TaxId:666] [117371] (3 PDB entries)
    Uniprot Q9KU37
  8. 1820104Domain d2oxna_: 2oxn A: [166910]
    automated match to d1tr9a_
    complexed with oan

Details for d2oxna_

PDB Entry: 2oxn (more details), 1.7 Å

PDB Description: Vibrio cholerae family 3 glycoside hydrolase (NagZ) in complex with PUGNAc
PDB Compounds: (A:) Beta-hexosaminidase

SCOPe Domain Sequences for d2oxna_:

Sequence; same for both SEQRES and ATOM records: (download)

>d2oxna_ c.1.8.7 (A:) Beta-hexosaminidase NagZ {Vibrio cholerae [TaxId: 666]}
mgplwldvagyelsaedreilqhptvggvilfgrnyhdnqqllalnkairqaakrpilig
vdqeggrvqrfregfsrippaqyyaraengvelaeqggwlmaaeliahdvdlsfapvldm
gfackaignrafgedvqtvlkhssaflrgmkavgmattgkhfpghgaviadshletpyde
retiaqdmaifraqieagvldammpahvvyphydaqpasgssywlkqvlreelgfkgivf
sddlsmegaavmggpvershqalvagcdmilicnkreaavevldnlpimevpqaeallkk
qqfsyselkrlerwqqasanmqrlieqfsehhh

SCOPe Domain Coordinates for d2oxna_:

Click to download the PDB-style file with coordinates for d2oxna_.
(The format of our PDB-style files is described here.)

Timeline for d2oxna_: