![]() | Class d: Alpha and beta proteins (a+b) [53931] (381 folds) |
![]() | Fold d.54: Enolase N-terminal domain-like [54825] (1 superfamily) beta(3)-alpha(3); meander and up-and-down bundle |
![]() | Superfamily d.54.1: Enolase N-terminal domain-like [54826] (2 families) ![]() |
![]() | Family d.54.1.0: automated matches [227195] (1 protein) not a true family |
![]() | Protein automated matches [226922] (83 species) not a true protein |
![]() | Species Oceanobacillus iheyensis [TaxId:182710] [255530] (3 PDB entries) |
![]() | Domain d2oqya1: 2oqy A:1-122 [243358] Other proteins in same PDB: d2oqya2, d2oqyb2, d2oqyc2, d2oqyd2, d2oqye2, d2oqyf2, d2oqyg2, d2oqyh2 automated match to d3sjna1 complexed with mg |
PDB Entry: 2oqy (more details), 2 Å
SCOPe Domain Sequences for d2oqya1:
Sequence; same for both SEQRES and ATOM records: (download)
>d2oqya1 d.54.1.0 (A:1-122) automated matches {Oceanobacillus iheyensis [TaxId: 182710]} mkitdlelhavgiprhtgfvnkhvivkihtdegltgigemsdfshlplysvdlhdlkqgl lsillgqnpfdlmkinkeltdnfpetmyyyekgsfirngidnalhdlcakyldisvsdfl gg
Timeline for d2oqya1: