![]() | Class d: Alpha and beta proteins (a+b) [53931] (376 folds) |
![]() | Fold d.148: Hect, E3 ligase catalytic domain [56203] (1 superfamily) consists of two alpha+beta domains; the N-terminal domain is array of helices and beta-hairpins; the C-terminal domain is an a/b sandwich with one left-handed beta-alpha(n)-beta unit; conformational flexibility of domain orientation |
![]() | Superfamily d.148.1: Hect, E3 ligase catalytic domain [56204] (2 families) ![]() automatically mapped to Pfam PF00632 |
![]() | Family d.148.1.0: automated matches [227207] (1 protein) not a true family |
![]() | Protein automated matches [226939] (1 species) not a true protein |
![]() | Species Human (Homo sapiens) [TaxId:9606] [225255] (6 PDB entries) |
![]() | Domain d2onia_: 2oni A: [205341] automated match to d1nd7a_ complexed with na |
PDB Entry: 2oni (more details), 2.2 Å
SCOPe Domain Sequences for d2onia_:
Sequence, based on SEQRES records: (download)
>d2onia_ d.148.1.0 (A:) automated matches {Human (Homo sapiens) [TaxId: 9606]} lyfqgsrefkqkydyfrkklkkpadipnrfemklhrnnifeesyrrimsvkrpdvlkarl wiefesekgldyggvarewffllskemfnpyyglfeysatdnytlqinpnsglcnedhls yftfigrvaglavfhgklldgffirpfykmmlgkqitlndmesvdseyynslkwilendp teldlmfcideenfgqtyqvdlkpngseimvtnenkreyidlviqwrfvnrvqkqmnafl egftellpidlikifdenelellmcglgdvdvndwrqhsiykngycpnhpviqwfwkavl lmdaekrirllqfvtgtsrvpmngfaelygsngpqlftieqwgspeklprahtcfnrldl ppyetfedlrekllmave
>d2onia_ d.148.1.0 (A:) automated matches {Human (Homo sapiens) [TaxId: 9606]} lyfqgsrefkqkydyfrkklkkpadipnrfemklhrnnifeesyrrimsvkrpdvlkarl wiefeekgldyggvarewffllskemfnpyyglfeysatdnytlqinpnsglcnedhlsy ftfigrvaglavfhgklldgffirpfykmmlgkqitlndmesvdseyynslkwilendpt eldlmfcideenfgqtyqvdlkpngseimvtnenkreyidlviqwrfvnrvqkqmnafle gftellpidlikifdenelellmcglgdvdvndwrqhsiykngycpnhpviqwfwkavll mdaekrirllqfvtgtsrvpmngfaelygsngpqlftieqwgspeklprahtcfnrldlp pyetfedlrekllmave
Timeline for d2onia_: