SCOPe 2.08: Domain d2oipe1: 2oip E:3-180

Lineage for d2oipe1 (2oip E:3-180)

Root: SCOPe 2.08
Class c: Alpha and beta proteins (a/b) [51349] (148 folds)
Fold c.71: Dihydrofolate reductase-like [53596] (1 superfamily)
3 layers: a/b/a; mixed beta-sheet of 8 strands, order 34251687; strand 8 is antiparallel to the rest
Superfamily c.71.1: Dihydrofolate reductase-like [53597] (3 families)
Family c.71.1.0: automated matches [191485] (1 protein)
not a true family
Protein automated matches [190777] (28 species)
not a true protein
Species Cryptosporidium hominis [TaxId:237895] [231999] (4 PDB entries)
Domain d2oipe1: 2oip E:3-180 [148792]
Other proteins in same PDB: d2oipa2, d2oipb2, d2oipc2, d2oipd2, d2oipe2
automated match to d2oipe1
complexed with cb3, mtx, ndp, ump; mutant

Details for d2oipe1

PDB Entry: 2oip (more details), 2.8 Å

PDB Description: crystal structure of the s290g active site mutant of ts-dhfr from cryptosporidium hominis

PDB Compounds: (E:) Chain A, crystal structure of Dhfr

SCOPe Domain Sequences for d2oipe1:

Sequence; same for both SEQRES and ATOM records: (download)

>d2oipe1 c.71.1.0 (E:3-180) automated matches {Cryptosporidium hominis [TaxId: 237895]}
eknvsivvaasvlssgigingqlpwsisedlkffskitnnkcdsnkknalimgrktwdsi
grrplknriivvissslpqdeadpnvvvfrnledsienlmnddsienifvcggesiyrda
lkdnfvdriyltrvalediefdtyfpeipetflpvymsqtfctknisydfmifekqek

SCOPe Domain Coordinates for d2oipe1:

Click to download the PDB-style file with coordinates for d2oipe1.
(The format of our PDB-style files is described here.)

Timeline for d2oipe1: