Lineage for d2ob4a_ (2ob4 A:)

  1. Root: SCOPe 2.06
  2. 2170735Class d: Alpha and beta proteins (a+b) [53931] (385 folds)
  3. 2183821Fold d.20: UBC-like [54494] (1 superfamily)
    alpha-beta(4)-alpha(3); core: meander beta-sheet plus one helix 2
  4. 2183822Superfamily d.20.1: UBC-like [54495] (5 families) (S)
  5. 2184242Family d.20.1.0: automated matches [191322] (1 protein)
    not a true family
  6. 2184243Protein automated matches [190120] (8 species)
    not a true protein
  7. 2184251Species Human (Homo sapiens) [TaxId:9606] [186843] (19 PDB entries)
  8. 2184269Domain d2ob4a_: 2ob4 A: [205244]
    automated match to d2cyxa_

Details for d2ob4a_

PDB Entry: 2ob4 (more details), 2.4 Å

PDB Description: Human Ubiquitin-Conjugating Enzyme CDC34
PDB Compounds: (A:) Ubiquitin-conjugating enzyme E2-32 kDa complementing

SCOPe Domain Sequences for d2ob4a_:

Sequence, based on SEQRES records: (download)

>d2ob4a_ d.20.1.0 (A:) automated matches {Human (Homo sapiens) [TaxId: 9606]}
sqkalllelkglqeepvegfrvtlvdegdlynwevaifgppntyyeggyfkarlkfpidy
pysppafrfltkmwhpniyetgdvcisilhppvddpqsgelpserwnptqnvrtillsvi
sllnepntfspanvdasvmyrkwkeskgkdreytdiirkqvlgtkvdaerdgv

Sequence, based on observed residues (ATOM records): (download)

>d2ob4a_ d.20.1.0 (A:) automated matches {Human (Homo sapiens) [TaxId: 9606]}
sqkalllelkglqeepvegfrvtlvdegdlynwevaifgppntyyeggyfkarlkfpidy
pysppafrfltkmwhpniyetgdvcisilhppvqnvrtillsvisllnepntfspanvda
svmyrkwkeskgkdreytdiirkqvlgtkvdaerdgv

SCOPe Domain Coordinates for d2ob4a_:

Click to download the PDB-style file with coordinates for d2ob4a_.
(The format of our PDB-style files is described here.)

Timeline for d2ob4a_: