Lineage for d2o95a_ (2o95 A:)

  1. Root: SCOPe 2.08
  2. 2826024Class c: Alpha and beta proteins (a/b) [51349] (148 folds)
  3. 2918481Fold c.97: Cytidine deaminase-like [53926] (2 superfamilies)
    core: alpha-beta(2)-(alpha-beta)2; 3 layers (a/b/a); mixed beta-sheet of 4 strands, order 2134; strand 1 is antiparallel to the rest
  4. 2918897Superfamily c.97.3: JAB1/MPN domain [102712] (2 families) (S)
  5. 2918898Family c.97.3.1: JAB1/MPN domain [102713] (8 proteins)
    Pfam PF01398; Pfam PF14464; synonyms Mov34, PAD-1. PubMed 17559875 asserts homology to (c.97.1)
  6. 2918917Protein Mov34 [267640] (1 species)
  7. 2918918Species Human (Homo sapiens) [TaxId:9606] [267699] (2 PDB entries)
  8. 2918919Domain d2o95a_: 2o95 A: [264431]
    complexed with 12p, ete, pg4, pge, so4

Details for d2o95a_

PDB Entry: 2o95 (more details), 1.95 Å

PDB Description: Crystal Structure of the Metal-Free Dimeric Human Mov34 MPN domain (residues 1-186)
PDB Compounds: (A:) 26S proteasome non-ATPase regulatory subunit 7

SCOPe Domain Sequences for d2o95a_:

Sequence, based on SEQRES records: (download)

>d2o95a_ c.97.3.1 (A:) Mov34 {Human (Homo sapiens) [TaxId: 9606]}
mpelavqkvvvhplvllsvvdhfnrigkvgnqkrvvgvllgswqkkvldvsnsfavpfde
ddkddsvwfldhdylenmygmfkkvnarerivgwyhtgpklhkndiainelmkrycpnsv
lviidvkpkdlglpteayisveevhddgtptsktfehvtseigaeeaeevgvehllrdik
dttv

Sequence, based on observed residues (ATOM records): (download)

>d2o95a_ c.97.3.1 (A:) Mov34 {Human (Homo sapiens) [TaxId: 9606]}
mpelavqkvvvhplvllsvvdhfnrigkvgnqkrvvgvllgswqkkvldvsnsfavpfde
ddkddsvwfldhdylenmygmfkkvnarerivgwyhtgpklhkndiainelmkrycpnsv
lviidvkpkdglpteayisveevhptsktfehvtseigaeeaeevgvehllrdikdttv

SCOPe Domain Coordinates for d2o95a_:

Click to download the PDB-style file with coordinates for d2o95a_.
(The format of our PDB-style files is described here.)

Timeline for d2o95a_: