Lineage for d2o5aa1 (2o5a A:2-114)
- Root: SCOPe 2.03
Class d: Alpha and beta proteins (a+b) [53931] (376 folds) 
Fold d.218: Nucleotidyltransferase [81302] (1 superfamily)
core: alpha-beta-turn-beta-X-beta-(alpha); mixed beta-sheet, order of core strands: 123Superfamily d.218.1: Nucleotidyltransferase [81301] (15 families) 
Family d.218.1.12: Iojap/YbeB-like [160252] (2 proteins)
Pfam PF02410, probably has evolved a different function; closer relationship to the GrpB-like familyProtein Uncharacterized protein BH1328 [160255] (1 species) Species Bacillus halodurans [TaxId:86665] [160256] (1 PDB entry)
Uniprot Q9KD89 2-114
Domain d2o5aa1: 2o5a A:2-114 [148593]
complexed with mn, so4
Details for d2o5aa1
PDB Entry: 2o5a (more details), 2.7 Å
PDB Description: crystal structure of q9kd89 from bacillus halodurans. northeast structural genomics target bhr21
PDB Compounds: (A:) BH1328 proteinSCOPe Domain Sequences for d2o5aa1:
Sequence, based on SEQRES records: (download)
>d2o5aa1 d.218.1.12 (A:2-114) Uncharacterized protein BH1328 {Bacillus halodurans [TaxId: 86665]}
snqellqlavnavddkkaeqvvalnmkgisliadfflichgnsekqvqaiahelkkvaqe
qgieikrlegyeqarwvlidlgdvvvhvfhkderayynleklwgdaptveleg
Sequence, based on observed residues (ATOM records): (download)
>d2o5aa1 d.218.1.12 (A:2-114) Uncharacterized protein BH1328 {Bacillus halodurans [TaxId: 86665]}
snqellqlavnavddkkaeqvvalnmkgisldfflichgnsekqvqaiahelkkvaqeqg
ieikrlegyeqarwvlidlgdvvvhvfhkderayynleklwptveleg
SCOPe Domain Coordinates for d2o5aa1:
Click to download the PDB-style file with coordinates for d2o5aa1.
(The format of our PDB-style files is described here.)
(The format of our PDB-style files is described here.)
Timeline for d2o5aa1:
- d2o5aa1 first appeared in SCOP 1.75
- d2o5aa1 appears in SCOPe 2.02
- d2o5aa1 appears in SCOPe 2.04
- d2o5aa1 appears in the current release, SCOPe 2.08
View in 3D
