Lineage for d2o3la1 (2o3l A:14-95)
- Root: SCOPe 2.05
Class a: All alpha proteins [46456] (286 folds) 
Fold a.69: Left-handed superhelix [47916] (4 superfamilies)
core: 4-5 helices; bundle; left-handed superhelix
Superfamily a.69.4: BH3980-like [158560] (1 family) 
automatically mapped to Pfam PF06304Family a.69.4.1: BH3980-like [158561] (3 proteins)
Pfam PF06304; DUF1048Protein Hypothetical protein BCE3448 [158562] (1 species) Species Bacillus cereus [TaxId:1396] [158563] (1 PDB entry)
Uniprot Q734F7 14-95
Domain d2o3la1: 2o3l A:14-95 [148579]
complexed with gol, so4
Details for d2o3la1
PDB Entry: 2o3l (more details), 2.05 Å
PDB Description: crystal structure of a duf1048 protein with a left-handed superhelix fold (bce_3448) from bacillus cereus atcc 10987 at 2.05 a resolution
PDB Compounds: (A:) hypothetical proteinSCOPe Domain Sequences for d2o3la1:
Sequence; same for both SEQRES and ATOM records: (download)
>d2o3la1 a.69.4.1 (A:14-95) Hypothetical protein BCE3448 {Bacillus cereus [TaxId: 1396]}
eykmmmarvaalpedyqfvfkkiqnymwnfsagngmdmlhiqyelidlfeagaaegrqvl
ditgedvasfadelvanaktyv
SCOPe Domain Coordinates for d2o3la1:
Click to download the PDB-style file with coordinates for d2o3la1.
(The format of our PDB-style files is described here.)
(The format of our PDB-style files is described here.)
Timeline for d2o3la1:
- d2o3la1 first appeared in SCOP 1.75
- d2o3la1 appears in SCOPe 2.04
- d2o3la1 appears in SCOPe 2.06
- d2o3la1 appears in the current release, SCOPe 2.08
View in 3D
