Class a: All alpha proteins [46456] (286 folds) |
Fold a.25: Ferritin-like [47239] (6 superfamilies) core: 4 helices; bundle, closed, left-handed twist; 1 crossover connection |
Superfamily a.25.1: Ferritin-like [47240] (10 families) contains bimetal-ion centre in the middle of the bundle |
Family a.25.1.2: Ribonucleotide reductase-like [47253] (9 proteins) |
Protein automated matches [190435] (9 species) not a true protein |
Species Plasmodium vivax [TaxId:5855] [226817] (1 PDB entry) |
Domain d2o1za_: 2o1z A: [205205] automated match to d4djnb_ complexed with fe, unx |
PDB Entry: 2o1z (more details), 2.4 Å
SCOPe Domain Sequences for d2o1za_:
Sequence, based on SEQRES records: (download)
>d2o1za_ a.25.1.2 (A:) automated matches {Plasmodium vivax [TaxId: 5855]} kkfsdlqkskeanekilsketdrftlypilypdvwdfykkaeasfwtaeeidlssdlkdf eklndnekhfikhvlaffaasdgivlenlaskflrqvkiteakkfyafqiavenihsety sllidnyikdekermnlfhaienipavknkalwaakwindtnsfaerivanacvegilfs gsfcaifwfkkqnklhgltfsnelisrdeglhtdfncliysllenklpeevvqnivkeav eversficeslpcdligmnsrlmsqyiefvadrlleclgspkifhaknpfnwmdl
>d2o1za_ a.25.1.2 (A:) automated matches {Plasmodium vivax [TaxId: 5855]} kkfsdlqkskeanekilsketdrftlypilypdvwdfykkaeasfwtaeeidlssdlkdf eklndnekhfikhvlaffaaslaskflrqvkiteakkfyafqiavenihsetysllidny ikdekermnlfhaienipavknkalwaakwindtnsfaerivanacvegilfsgsfcaif wfkkqnklhgltfsnelisrdeglhtdfncliysllenklpeevvqnivkeaveversfi ceslpcdligmnsrlmsqyiefvadrlleclgspkifhaknpfnwmdl
Timeline for d2o1za_: