Class c: Alpha and beta proteins (a/b) [51349] (148 folds) |
Fold c.94: Periplasmic binding protein-like II [53849] (1 superfamily) consists of two similar intertwined domain with 3 layers (a/b/a) each: duplication mixed beta-sheet of 5 strands, order 21354; strand 5 is antiparallel to the rest |
Superfamily c.94.1: Periplasmic binding protein-like II [53850] (4 families) Similar in architecture to the superfamily I but partly differs in topology |
Family c.94.1.1: Phosphate binding protein-like [53851] (45 proteins) has additional insertions and/or extensions that are not grouped together |
Protein Hypothetical protein SCo4506 [159810] (1 species) |
Species Streptomyces coelicolor [TaxId:1902] [159811] (1 PDB entry) Uniprot Q9L0T8 6-282 |
Domain d2nxoa1: 2nxo A:5-281 [148500] member of Pfam PF02621; DUF178 has additional insertions and/or extensions that are not grouped together |
PDB Entry: 2nxo (more details), 2.04 Å
SCOPe Domain Sequences for d2nxoa1:
Sequence, based on SEQRES records: (download)
>d2nxoa1 c.94.1.1 (A:5-281) Hypothetical protein SCo4506 {Streptomyces coelicolor [TaxId: 1902]} trprvghiqflnclplywglartgtlldfeltkdtpeklseqlvrgdldigpvtlveflk naddlvafpdiavgcdgpvmscvivsqvpldrldgarvalgstsrtsvrlaqlllserfg vqpdyytcppdlslmmqeadaavligdaalranmidgprygldvhdlgalwkewtglpfv favwaarrdyaerepvitrkvheaflasrnlsleevekvaeqaarweafdedtlakyftt ldfrfgapqleavtefarrvgpttgfpadvkvellkp
>d2nxoa1 c.94.1.1 (A:5-281) Hypothetical protein SCo4506 {Streptomyces coelicolor [TaxId: 1902]} trprvghiqflnclplywglartgtlldfeltkdtpeklseqlvrgdldigpvtlveflk naddlvafpdiavgcdgpvmscvivsqvpldrldgarvalgstsrtsvrlaqlllserfg vqpdyytcppdlslmaavligdaalranmidgprygldvhdlgalwkewtglpfvfavwa arrdyaerepvitrkvheaflasrnlsleevekvaeqaarweafdedtlakyfttldfrf gapqleavtefarrvgpttgfpadvkvellkp
Timeline for d2nxoa1: