Lineage for d2nxoa1 (2nxo A:5-281)

  1. Root: SCOPe 2.08
  2. 2826024Class c: Alpha and beta proteins (a/b) [51349] (148 folds)
  3. 2913607Fold c.94: Periplasmic binding protein-like II [53849] (1 superfamily)
    consists of two similar intertwined domain with 3 layers (a/b/a) each: duplication
    mixed beta-sheet of 5 strands, order 21354; strand 5 is antiparallel to the rest
  4. 2913608Superfamily c.94.1: Periplasmic binding protein-like II [53850] (4 families) (S)
    Similar in architecture to the superfamily I but partly differs in topology
  5. 2913609Family c.94.1.1: Phosphate binding protein-like [53851] (45 proteins)
    has additional insertions and/or extensions that are not grouped together
  6. 2914324Protein Hypothetical protein SCo4506 [159810] (1 species)
  7. 2914325Species Streptomyces coelicolor [TaxId:1902] [159811] (1 PDB entry)
    Uniprot Q9L0T8 6-282
  8. 2914326Domain d2nxoa1: 2nxo A:5-281 [148500]
    member of Pfam PF02621; DUF178
    has additional insertions and/or extensions that are not grouped together

Details for d2nxoa1

PDB Entry: 2nxo (more details), 2.04 Å

PDB Description: crystal structure of protein sco4506 from streptomyces coelicolor, pfam duf178
PDB Compounds: (A:) Hypothetical protein SCO4506

SCOPe Domain Sequences for d2nxoa1:

Sequence, based on SEQRES records: (download)

>d2nxoa1 c.94.1.1 (A:5-281) Hypothetical protein SCo4506 {Streptomyces coelicolor [TaxId: 1902]}
trprvghiqflnclplywglartgtlldfeltkdtpeklseqlvrgdldigpvtlveflk
naddlvafpdiavgcdgpvmscvivsqvpldrldgarvalgstsrtsvrlaqlllserfg
vqpdyytcppdlslmmqeadaavligdaalranmidgprygldvhdlgalwkewtglpfv
favwaarrdyaerepvitrkvheaflasrnlsleevekvaeqaarweafdedtlakyftt
ldfrfgapqleavtefarrvgpttgfpadvkvellkp

Sequence, based on observed residues (ATOM records): (download)

>d2nxoa1 c.94.1.1 (A:5-281) Hypothetical protein SCo4506 {Streptomyces coelicolor [TaxId: 1902]}
trprvghiqflnclplywglartgtlldfeltkdtpeklseqlvrgdldigpvtlveflk
naddlvafpdiavgcdgpvmscvivsqvpldrldgarvalgstsrtsvrlaqlllserfg
vqpdyytcppdlslmaavligdaalranmidgprygldvhdlgalwkewtglpfvfavwa
arrdyaerepvitrkvheaflasrnlsleevekvaeqaarweafdedtlakyfttldfrf
gapqleavtefarrvgpttgfpadvkvellkp

SCOPe Domain Coordinates for d2nxoa1:

Click to download the PDB-style file with coordinates for d2nxoa1.
(The format of our PDB-style files is described here.)

Timeline for d2nxoa1: