Class c: Alpha and beta proteins (a/b) [51349] (148 folds) |
Fold c.1: TIM beta/alpha-barrel [51350] (34 superfamilies) contains parallel beta-sheet barrel, closed; n=8, S=8; strand order 12345678 the first seven superfamilies have similar phosphate-binding sites |
Superfamily c.1.8: (Trans)glycosidases [51445] (15 families) |
Family c.1.8.0: automated matches [191314] (1 protein) not a true family |
Protein automated matches [190075] (132 species) not a true protein |
Species Unidentified phage [TaxId:38018] [193872] (1 PDB entry) |
Domain d2nw0b_: 2nw0 B: [193873] automated match to d3hmca_ complexed with act |
PDB Entry: 2nw0 (more details), 1.6 Å
SCOPe Domain Sequences for d2nw0b_:
Sequence; same for both SEQRES and ATOM records: (download)
>d2nw0b_ c.1.8.0 (B:) automated matches {Unidentified phage [TaxId: 38018]} gyivdmskwngspdwdtakgqldlviarvqdgsnyvdpvykdyvaamkarnipfgsyafc rfvsvedakveardfwnrgdkdslfwvadvevttmsdmragtqafidelyrlgakkvgly vghhkyeefgaaqikcdftwiprygakpaypcdlwqydeygqvpgigkcdlnrlngdksl dwftgkgee
Timeline for d2nw0b_: