Lineage for d2nw0b_ (2nw0 B:)

  1. Root: SCOPe 2.08
  2. 2826024Class c: Alpha and beta proteins (a/b) [51349] (148 folds)
  3. 2826025Fold c.1: TIM beta/alpha-barrel [51350] (34 superfamilies)
    contains parallel beta-sheet barrel, closed; n=8, S=8; strand order 12345678
    the first seven superfamilies have similar phosphate-binding sites
  4. 2829818Superfamily c.1.8: (Trans)glycosidases [51445] (15 families) (S)
  5. 2832343Family c.1.8.0: automated matches [191314] (1 protein)
    not a true family
  6. 2832344Protein automated matches [190075] (132 species)
    not a true protein
  7. 2833314Species Unidentified phage [TaxId:38018] [193872] (1 PDB entry)
  8. 2833316Domain d2nw0b_: 2nw0 B: [193873]
    automated match to d3hmca_
    complexed with act

Details for d2nw0b_

PDB Entry: 2nw0 (more details), 1.6 Å

PDB Description: Crystal structure of a lysin
PDB Compounds: (B:) PlyB

SCOPe Domain Sequences for d2nw0b_:

Sequence; same for both SEQRES and ATOM records: (download)

>d2nw0b_ c.1.8.0 (B:) automated matches {Unidentified phage [TaxId: 38018]}
gyivdmskwngspdwdtakgqldlviarvqdgsnyvdpvykdyvaamkarnipfgsyafc
rfvsvedakveardfwnrgdkdslfwvadvevttmsdmragtqafidelyrlgakkvgly
vghhkyeefgaaqikcdftwiprygakpaypcdlwqydeygqvpgigkcdlnrlngdksl
dwftgkgee

SCOPe Domain Coordinates for d2nw0b_:

Click to download the PDB-style file with coordinates for d2nw0b_.
(The format of our PDB-style files is described here.)

Timeline for d2nw0b_: