Lineage for d2nptb1 (2npt B:42-123)

  1. Root: SCOPe 2.06
  2. 2170735Class d: Alpha and beta proteins (a+b) [53931] (385 folds)
  3. 2177211Fold d.15: beta-Grasp (ubiquitin-like) [54235] (14 superfamilies)
    core: beta(2)-alpha-beta(2); mixed beta-sheet 2143
  4. 2179003Superfamily d.15.2: CAD & PB1 domains [54277] (3 families) (S)
    contain extra helix; similar heterodimerization modes; possibly related to the ubiquitin-like superfamily
  5. 2179019Family d.15.2.2: PB1 domain [64225] (11 proteins)
    Pfam PF00564
    forms heterodimers, although not all PB1 domain pairs associate.
  6. 2179036Protein Mitogen-activated protein kinase kinase kinase 2, MEKK 2 [142976] (1 species)
  7. 2179037Species Human (Homo sapiens) [TaxId:9606] [142977] (2 PDB entries)
    Uniprot Q9Y2U5 42-123! Uniprot Q9Y2U5 43-132
  8. 2179038Domain d2nptb1: 2npt B:42-123 [138449]
    Other proteins in same PDB: d2npta1, d2npta2, d2nptc2, d2nptc3

Details for d2nptb1

PDB Entry: 2npt (more details), 1.75 Å

PDB Description: Crystal Structure of the complex of human mitogen activated protein kinase kinase 5 phox domain (MAP2K5-phox) with human mitogen activated protein kinase kinase kinase 2 phox domain (MAP3K2-phox)
PDB Compounds: (B:) Mitogen-activated protein kinase kinase kinase 2

SCOPe Domain Sequences for d2nptb1:

Sequence; same for both SEQRES and ATOM records: (download)

>d2nptb1 d.15.2.2 (B:42-123) Mitogen-activated protein kinase kinase kinase 2, MEKK 2 {Human (Homo sapiens) [TaxId: 9606]}
ndvrvkfehrgekrilqfprpvkledlrskakiafgqsmdlhytnnelviplttqddldk
avelldrsihmkslkillving

SCOPe Domain Coordinates for d2nptb1:

Click to download the PDB-style file with coordinates for d2nptb1.
(The format of our PDB-style files is described here.)

Timeline for d2nptb1: