Lineage for d2npta1 (2npt A:4-108)

  1. Root: SCOPe 2.03
  2. 1396887Class d: Alpha and beta proteins (a+b) [53931] (376 folds)
  3. 1402144Fold d.15: beta-Grasp (ubiquitin-like) [54235] (14 superfamilies)
    core: beta(2)-alpha-beta(2); mixed beta-sheet 2143
  4. 1403055Superfamily d.15.2: CAD & PB1 domains [54277] (2 families) (S)
    contain extra helix; similar heterodimerization modes; possibly related to the ubiquitin-like superfamily
  5. 1403071Family d.15.2.2: PB1 domain [64225] (11 proteins)
    Pfam PF00564
    forms heterodimers, although not all PB1 domain pairs associate.
  6. 1403081Protein Mitogen activated protein kinase kinase 5, Map2k5 [117827] (2 species)
  7. 1403082Species Human (Homo sapiens) [TaxId:9606] [142975] (2 PDB entries)
    Uniprot Q13163 4-108
  8. 1403083Domain d2npta1: 2npt A:4-108 [138448]
    Other proteins in same PDB: d2nptb1, d2nptd_

Details for d2npta1

PDB Entry: 2npt (more details), 1.75 Å

PDB Description: Crystal Structure of the complex of human mitogen activated protein kinase kinase 5 phox domain (MAP2K5-phox) with human mitogen activated protein kinase kinase kinase 2 phox domain (MAP3K2-phox)
PDB Compounds: (A:) Dual specificity mitogen-activated protein kinase kinase 5

SCOPe Domain Sequences for d2npta1:

Sequence, based on SEQRES records: (download)

>d2npta1 d.15.2.2 (A:4-108) Mitogen activated protein kinase kinase 5, Map2k5 {Human (Homo sapiens) [TaxId: 9606]}
malgpfpamenqvlvirikipnsgavdwtvhsgpqllfrdvldvigqvlpeatttafeye
dedgdritvrsdeemkamlsyyystvmeqqvngqlieplqifpra

Sequence, based on observed residues (ATOM records): (download)

>d2npta1 d.15.2.2 (A:4-108) Mitogen activated protein kinase kinase 5, Map2k5 {Human (Homo sapiens) [TaxId: 9606]}
malgpfpamqvlvirikipnsgavdwtvhsqllfrdvldvigqvlpeatttafeyededg
dritvrsdeemkamlsyyystvmeqqvngqlieplqifpra

SCOPe Domain Coordinates for d2npta1:

Click to download the PDB-style file with coordinates for d2npta1.
(The format of our PDB-style files is described here.)

Timeline for d2npta1: