Lineage for d2mnra2 (2mnr A:3-132)

  1. Root: SCOPe 2.06
  2. 2170735Class d: Alpha and beta proteins (a+b) [53931] (385 folds)
  3. 2191243Fold d.54: Enolase N-terminal domain-like [54825] (1 superfamily)
    beta(3)-alpha(3); meander and up-and-down bundle
  4. 2191244Superfamily d.54.1: Enolase N-terminal domain-like [54826] (2 families) (S)
  5. 2191245Family d.54.1.1: Enolase N-terminal domain-like [54827] (15 proteins)
    C-terminal domain is beta/alpha-barrel
  6. 2191432Protein Mandelate racemase [54838] (3 species)
  7. 2191447Species Pseudomonas putida [TaxId:303] [54839] (6 PDB entries)
  8. 2191448Domain d2mnra2: 2mnr A:3-132 [38889]
    Other proteins in same PDB: d2mnra1
    complexed with mn, so4

Details for d2mnra2

PDB Entry: 2mnr (more details), 1.9 Å

PDB Description: mechanism of the reaction catalyzed by mandelate racemase. 2. crystal structure of mandelate racemase at 2.5 angstroms resolution: identification of the active site and possible catalytic residues
PDB Compounds: (A:) mandelate racemase

SCOPe Domain Sequences for d2mnra2:

Sequence; same for both SEQRES and ATOM records: (download)

>d2mnra2 d.54.1.1 (A:3-132) Mandelate racemase {Pseudomonas putida [TaxId: 303]}
evlitglrtravnvplaypvhtavgtvgtaplvlidlatsagvvghsylfaytpvalksl
kqllddmaamivneplapvsleamlakrfclagytglirmaaagidmaawdalgkvhetp
lvkllganar

SCOPe Domain Coordinates for d2mnra2:

Click to download the PDB-style file with coordinates for d2mnra2.
(The format of our PDB-style files is described here.)

Timeline for d2mnra2:

View in 3D
Domains from same chain:
(mouse over for more information)
d2mnra1