Class d: Alpha and beta proteins (a+b) [53931] (381 folds) |
Fold d.15: beta-Grasp (ubiquitin-like) [54235] (14 superfamilies) core: beta(2)-alpha-beta(2); mixed beta-sheet 2143 |
Superfamily d.15.4: 2Fe-2S ferredoxin-like [54292] (3 families) |
Family d.15.4.0: automated matches [191632] (1 protein) not a true family |
Protein automated matches [191164] (14 species) not a true protein |
Species Baker's yeast (Saccharomyces cerevisiae) [TaxId:559292] [261090] (2 PDB entries) |
Domain d2mjea_: 2mje A: [261091] automated match to d2y5ca_ complexed with fes |
PDB Entry: 2mje (more details)
SCOPe Domain Sequences for d2mjea_:
Sequence; same for both SEQRES and ATOM records: (download)
>d2mjea_ d.15.4.0 (A:) automated matches {Baker's yeast (Saccharomyces cerevisiae) [TaxId: 559292]} geelkitfilkdgsqktyevcegetildiaqghnldmegacggscacstchvivdpdyyd alpepeddendmldlaygltetsrlgcqikmskdidgirvalpqmtrnvnnndfs
Timeline for d2mjea_: