Lineage for d2mjea_ (2mje A:)

  1. Root: SCOPe 2.05
  2. 1886641Class d: Alpha and beta proteins (a+b) [53931] (381 folds)
  3. 1892544Fold d.15: beta-Grasp (ubiquitin-like) [54235] (14 superfamilies)
    core: beta(2)-alpha-beta(2); mixed beta-sheet 2143
  4. 1894040Superfamily d.15.4: 2Fe-2S ferredoxin-like [54292] (3 families) (S)
  5. 1894403Family d.15.4.0: automated matches [191632] (1 protein)
    not a true family
  6. 1894404Protein automated matches [191164] (14 species)
    not a true protein
  7. 1894405Species Baker's yeast (Saccharomyces cerevisiae) [TaxId:559292] [261090] (2 PDB entries)
  8. 1894406Domain d2mjea_: 2mje A: [261091]
    automated match to d2y5ca_
    complexed with fes

Details for d2mjea_

PDB Entry: 2mje (more details)

PDB Description: Reduced Yeast Adrenodoxin Homolog 1
PDB Compounds: (A:) Adrenodoxin homolog, mitochondrial

SCOPe Domain Sequences for d2mjea_:

Sequence; same for both SEQRES and ATOM records: (download)

>d2mjea_ d.15.4.0 (A:) automated matches {Baker's yeast (Saccharomyces cerevisiae) [TaxId: 559292]}
geelkitfilkdgsqktyevcegetildiaqghnldmegacggscacstchvivdpdyyd
alpepeddendmldlaygltetsrlgcqikmskdidgirvalpqmtrnvnnndfs

SCOPe Domain Coordinates for d2mjea_:

Click to download the PDB-style file with coordinates for d2mjea_.
(The format of our PDB-style files is described here.)

Timeline for d2mjea_: