Lineage for d2mfna1 (2mfn A:1-92)
- Root: SCOPe 2.06
Class b: All beta proteins [48724] (177 folds) 
Fold b.1: Immunoglobulin-like beta-sandwich [48725] (33 superfamilies)
sandwich; 7 strands in 2 sheets; greek-key
some members of the fold have additional strands
Superfamily b.1.2: Fibronectin type III [49265] (2 families) 
Family b.1.2.1: Fibronectin type III [49266] (45 proteins)
Pfam PF00041
Protein Fibronectin, different Fn3 modules [49270] (3 species) 
Species Mouse (Mus musculus) [TaxId:10090] [49272] (2 PDB entries) 
Domain d2mfna1: 2mfn A:1-92 [21982]
Details for d2mfna1
PDB Entry: 2mfn (more details)
PDB Description: solution nmr structure of linked cell attachment modules of mouse fibronectin containing the rgd and synergy regions, 10 structures
PDB Compounds: (A:) FibronectinSCOPe Domain Sequences for d2mfna1:
Sequence; same for both SEQRES and ATOM records: (download)
>d2mfna1 b.1.2.1 (A:1-92) Fibronectin, different Fn3 modules {Mouse (Mus musculus) [TaxId: 10090]}
gldsptgfdssditansftvhwvaprapitgyiirhhaehsvgrprqdrvppsrnsitlt
nlnpgteyvvsiiavngreesppligqqatvs
SCOPe Domain Coordinates for d2mfna1:
Click to download the PDB-style file with coordinates for d2mfna1.
(The format of our PDB-style files is described here.)
(The format of our PDB-style files is described here.)
Timeline for d2mfna1:
- d2mfna1 first appeared (with stable ids) in SCOP 1.55, called d2mfn_1
- d2mfna1 appears in SCOPe 2.05
- d2mfna1 appears in SCOPe 2.07
- d2mfna1 appears in the current release, SCOPe 2.08
View in 3D
