Lineage for d2m8lb1 (2m8l B:1-147)
- Root: SCOPe 2.04
Class a: All alpha proteins [46456] (285 folds) 
Fold a.73: Retrovirus capsid protein, N-terminal core domain [47942] (1 superfamily)
core: 5 helices; bundleSuperfamily a.73.1: Retrovirus capsid protein, N-terminal core domain [47943] (2 families) 
Family a.73.1.1: Retrovirus capsid protein, N-terminal core domain [47944] (6 proteins) 
Protein HIV-1 capsid protein [47945] (1 species) Species Human immunodeficiency virus type 1 [TaxId:11676] [47946] (30 PDB entries) 
Domain d2m8lb1: 2m8l B:1-147 [243142]
Other proteins in same PDB: d2m8la2, d2m8lb2
automated match to d3ntea1
Details for d2m8lb1
PDB Entry: 2m8l (more details)
PDB Description: hiv capsid dimer structure
PDB Compounds: (B:) capsid protein p24SCOPe Domain Sequences for d2m8lb1:
Sequence; same for both SEQRES and ATOM records: (download)
>d2m8lb1 a.73.1.1 (B:1-147) HIV-1 capsid protein {Human immunodeficiency virus type 1 [TaxId: 11676]}
pivqnlqgqmvhqaisprtlnawvkvveekafspevipmfsalsegatpqdlntmlntvg
ghqaamqmlketineeaaewdrlhpvhagpiapgqmreprgsdiagttstlqeqigwmth
nppipvgeiykrwiilglnkivrmysp
SCOPe Domain Coordinates for d2m8lb1:
Click to download the PDB-style file with coordinates for d2m8lb1.
(The format of our PDB-style files is described here.)
(The format of our PDB-style files is described here.)
Timeline for d2m8lb1:
- d2m8lb1 is new in SCOPe 2.04-stable
- d2m8lb1 appears in SCOPe 2.05
- d2m8lb1 appears in the current release, SCOPe 2.08
View in 3D
