Class d: Alpha and beta proteins (a+b) [53931] (396 folds) |
Fold d.15: beta-Grasp (ubiquitin-like) [54235] (15 superfamilies) core: beta(2)-alpha-beta(2); mixed beta-sheet 2143 |
Superfamily d.15.1: Ubiquitin-like [54236] (11 families) |
Family d.15.1.0: automated matches [191343] (1 protein) not a true family |
Protein automated matches [190233] (31 species) not a true protein |
Species Trypanosoma brucei [TaxId:999953] [229344] (2 PDB entries) |
Domain d2lrwa_: 2lrw A: [242984] automated match to d3rula_ |
PDB Entry: 2lrw (more details)
SCOPe Domain Sequences for d2lrwa_:
Sequence; same for both SEQRES and ATOM records: (download)
>d2lrwa_ d.15.1.0 (A:) automated matches {Trypanosoma brucei [TaxId: 999953]} mllkvktvsnkviqitsltddntiaelkgkleesegipgnmirlvyqgkqledekrlkdy qmsagatfhmvvalragc
Timeline for d2lrwa_: