| Class c: Alpha and beta proteins (a/b) [51349] (148 folds) |
| Fold c.56: Phosphorylase/hydrolase-like [53162] (8 superfamilies) core: 3 layers, a/b/a ; mixed sheet of 5 strands: order 21354; strand 4 is antiparallel to the rest; contains crossover loops |
Superfamily c.56.3: Peptidyl-tRNA hydrolase-like [53178] (2 families) ![]() |
| Family c.56.3.0: automated matches [193325] (1 protein) not a true family |
| Protein automated matches [193326] (10 species) not a true protein |
| Species Mycobacterium smegmatis [TaxId:246196] [225939] (5 PDB entries) |
| Domain d2lgja_: 2lgj A: [242875] automated match to d3p2ja_ |
PDB Entry: 2lgj (more details)
SCOPe Domain Sequences for d2lgja_:
Sequence; same for both SEQRES and ATOM records: (download)
>d2lgja_ c.56.3.0 (A:) automated matches {Mycobacterium smegmatis [TaxId: 246196]}
maepllvvglgnpgptyaktrhnlgfmvadvlagrigsafkvhkksgaevvtgrlagtsv
vlakprcymnesgrqvgplakfysvppqqivvihdeldidfgrirlklgggegghnglrs
vasalgtknfhrvrigvgrppgrkdpaafvlenftaaeraevptiveqaadatelliaqg
lepaqntvhaw
Timeline for d2lgja_: