Class a: All alpha proteins [46456] (286 folds) |
Fold a.4: DNA/RNA-binding 3-helical bundle [46688] (14 superfamilies) core: 3-helices; bundle, closed or partly opened, right-handed twist; up-and down |
Superfamily a.4.5: "Winged helix" DNA-binding domain [46785] (85 families) contains a small beta-sheet (wing) |
Family a.4.5.0: automated matches [191329] (1 protein) not a true family |
Protein automated matches [190154] (57 species) not a true protein |
Species Mouse (Mus musculus) [TaxId:10090] [189892] (3 PDB entries) |
Domain d2lf7a_: 2lf7 A: [242868] automated match to d4avpa_ |
PDB Entry: 2lf7 (more details)
SCOPe Domain Sequences for d2lf7a_:
Sequence; same for both SEQRES and ATOM records: (download)
>d2lf7a_ a.4.5.0 (A:) automated matches {Mouse (Mus musculus) [TaxId: 10090]} gshmrllwdyvyqllsdsryenfirwedkeskifrivdpnglarlwgnhknrtnmtyekm sralrhyyklniirkepgqrllfrfmktpdeimsgrtdrlehlesq
Timeline for d2lf7a_: