Lineage for d2k45a_ (2k45 A:)

  1. Root: SCOPe 2.06
  2. 2021373Class b: All beta proteins [48724] (177 folds)
  3. 2045100Fold b.7: C2 domain-like [49561] (5 superfamilies)
    sandwich; 8 strands in 2 sheets; greek-key
  4. 2045101Superfamily b.7.1: C2 domain (Calcium/lipid-binding domain, CaLB) [49562] (3 families) (S)
    two constituent families are related by circular permutation
  5. 2045249Family b.7.1.2: Synaptotagmin-like (S variant) [49575] (11 proteins)
    topologically similar to the C-terminal domain of PapD
  6. 2045274Protein Synaptogamin I [49576] (3 species)
    duplication: contains tandem repeat of two similar domains
  7. 2045275Species Human (Homo sapiens) [TaxId:9606] [158946] (10 PDB entries)
  8. 2045287Domain d2k45a_: 2k45 A: [242370]
    automated match to d1byna_

Details for d2k45a_

PDB Entry: 2k45 (more details)

PDB Description: c2a domain of synaptototagmin i solution structure in the fgf-1-c2a binary complex: key component in the fibroblast growthfactor non- classical pathway
PDB Compounds: (A:) Synaptotagmin-1

SCOPe Domain Sequences for d2k45a_:

Sequence; same for both SEQRES and ATOM records: (download)

>d2k45a_ b.7.1.2 (A:) Synaptogamin I {Human (Homo sapiens) [TaxId: 9606]}
eklgklqysldydfqnnqllvgiiqaaelpaldmggtsdpyvkvfllpdkkkkfetkvhr
ktlnpvfneqftfkvpyselggktlvmavydfdrfskhdiigefkvpmntvdfghvteew
rdlqsaek

SCOPe Domain Coordinates for d2k45a_:

Click to download the PDB-style file with coordinates for d2k45a_.
(The format of our PDB-style files is described here.)

Timeline for d2k45a_: