Lineage for d2jlsa2 (2jls A:483-618)
- Root: SCOPe 2.08
Class c: Alpha and beta proteins (a/b) [51349] (148 folds) 
Fold c.37: P-loop containing nucleoside triphosphate hydrolases [52539] (1 superfamily)
3 layers: a/b/a, parallel or mixed beta-sheets of variable sizesSuperfamily c.37.1: P-loop containing nucleoside triphosphate hydrolases [52540] (27 families) 
division into families based on beta-sheet topologies
Family c.37.1.0: automated matches [191323] (1 protein)
not a true familyProtein automated matches [190123] (158 species)
not a true protein
Species Dengue virus 4 [TaxId:408688] [230938] (4 PDB entries) 
Domain d2jlsa2: 2jls A:483-618 [230951]
Other proteins in same PDB: d2jlsa1
automated match to d2bhra1
protein/RNA complex; complexed with adp, bme, cl, gol, mn
Details for d2jlsa2
PDB Entry: 2jls (more details), 2.23 Å
PDB Description: dengue virus 4 ns3 helicase in complex with adp
PDB Compounds: (A:) serine protease subunit ns3SCOPe Domain Sequences for d2jlsa2:
Sequence; same for both SEQRES and ATOM records: (download)
>d2jlsa2 c.37.1.0 (A:483-618) automated matches {Dengue virus 4 [TaxId: 408688]}
edhahwteakmlldniytpegiiptlfgperektqaidgefrlrgeqrktfvelmrrgdl
pvwlsykvasagisykdrewcftgernnqileenmeveiwtregekkklrpkwldarvya
dpmalkdfkefasgrk
SCOPe Domain Coordinates for d2jlsa2:
Click to download the PDB-style file with coordinates for d2jlsa2.
(The format of our PDB-style files is described here.)
(The format of our PDB-style files is described here.)
Timeline for d2jlsa2:
- d2jlsa2 first appeared in SCOPe 2.03
- d2jlsa2 appears in SCOPe 2.07
View in 3D
