Lineage for d2j96a_ (2j96 A:)
- Root: SCOPe 2.06
Class a: All alpha proteins [46456] (289 folds) 
Fold a.1: Globin-like [46457] (2 superfamilies)
core: 6 helices; folded leaf, partly openedSuperfamily a.1.1: Globin-like [46458] (5 families) 
Family a.1.1.3: Phycocyanin-like phycobilisome proteins [46532] (7 proteins)
oligomers of two different types of globin-like subunits containing two extra helices at the N-terminus
binds a bilin chromophore
automatically mapped to Pfam PF00502
Protein automated matches [190531] (18 species)
not a true protein
Species Mastigocladus laminosus [TaxId:83541] [187515] (3 PDB entries) 
Domain d2j96a_: 2j96 A: [165947]
automated match to d1i7ya_
complexed with pvn
Details for d2j96a_
PDB Entry: 2j96 (more details), 2.25 Å
PDB Description: the e-configuration of alfa-phycoerythrocyanin
PDB Compounds: (A:) phycoerythrocyanin alpha chainSCOPe Domain Sequences for d2j96a_:
Sequence; same for both SEQRES and ATOM records: (download)
>d2j96a_ a.1.1.3 (A:) automated matches {Mastigocladus laminosus [TaxId: 83541]}
mktplteaiaaadlrgsylsntelqavfgrfnraragleaarafanngkkwaeaaanhvy
qkfpyttqmqgpqyastpegkakcvrdidhylrtisyccvvggtgplddyvvaglkefns
alglspswyiaalefvrdnhgltgdvageantyinyainals
SCOPe Domain Coordinates for d2j96a_:
Click to download the PDB-style file with coordinates for d2j96a_.
(The format of our PDB-style files is described here.)
(The format of our PDB-style files is described here.)
Timeline for d2j96a_:
- d2j96a_ first appeared in SCOPe 2.01
- d2j96a_ appears in SCOPe 2.05
- d2j96a_ appears in SCOPe 2.07
- d2j96a_ appears in the current release, SCOPe 2.08
View in 3D
