Lineage for d2j8cm_ (2j8c M:)
- Root: SCOPe 2.02
Class f: Membrane and cell surface proteins and peptides [56835] (57 folds) 
Fold f.26: Bacterial photosystem II reaction centre, L and M subunits [81484] (1 superfamily)
five transmembrane helices forming a sheet-like structureSuperfamily f.26.1: Bacterial photosystem II reaction centre, L and M subunits [81483] (1 family) 
Family f.26.1.1: Bacterial photosystem II reaction centre, L and M subunits [81482] (5 proteins)
L and M are probably related to each otherProtein automated matches [190224] (5 species)
not a true protein
Species Rhodobacter sphaeroides [TaxId:1063] [186985] (37 PDB entries) 
Domain d2j8cm_: 2j8c M: [147910]
automated match to d1ystm_
complexed with bcl, bph, cdl, fe, ggd, gol, hto, lda, pc1, po4, spo, u10
Details for d2j8cm_
PDB Entry: 2j8c (more details), 1.87 Å
PDB Description: x-ray high resolution structure of the photosynthetic reaction center from rb. sphaeroides at ph 8 in the neutral state
PDB Compounds: (M:) reaction center protein m chainSCOPe Domain Sequences for d2j8cm_:
Sequence; same for both SEQRES and ATOM records: (download)
>d2j8cm_ f.26.1.1 (M:) automated matches {Rhodobacter sphaeroides [TaxId: 1063]}
aeyqnifsqvqvrgpadlgmtedvnlanrsgvgpfstllgwfgnaqlgpiylgslgvlsl
fsglmwfftigiwfwyqagwnpavflrdlfffsleppapeyglsfaaplkegglwliasf
fmfvavwswwgrtylraqalgmgkhtawaflsaiwlwmvlgfirpilmgswseavpygif
shldwtnnfslvhgnlfynpfhglsiaflygsallfamhgatilavsrfggereleqiad
rgtaaeraalfwrwtmgfnatmegihrwaiwmavlvtltggigillsgtvvdnwyvwgqn
hgm
SCOPe Domain Coordinates for d2j8cm_:
Click to download the PDB-style file with coordinates for d2j8cm_.
(The format of our PDB-style files is described here.)
(The format of our PDB-style files is described here.)
Timeline for d2j8cm_:
- d2j8cm_ first appeared in SCOP 1.75, called d2j8cm1
- d2j8cm_ appears in SCOPe 2.01
- d2j8cm_ appears in SCOPe 2.03
- d2j8cm_ appears in the current release, SCOPe 2.08
View in 3D
