SCOPe 2.05: Domain d2j6ea1: 2j6e A:236-339

Lineage for d2j6ea1 (2j6e A:236-339)

Root: SCOPe 2.05
Class b: All beta proteins [48724] (176 folds)
Fold b.1: Immunoglobulin-like beta-sandwich [48725] (31 superfamilies)
sandwich; 7 strands in 2 sheets; greek-key
some members of the fold have additional strands
Superfamily b.1.1: Immunoglobulin [48726] (5 families)
Family b.1.1.2: C1 set domains (antibody constant domain-like) [48942] (24 proteins)
Protein automated matches [190374] (14 species)
not a true protein
Species Human (Homo sapiens) [TaxId:9606] [187221] (409 PDB entries)
Domain d2j6ea1: 2j6e A:236-339 [138080]
Other proteins in same PDB: d2j6eh1, d2j6eh2, d2j6ei1, d2j6ei2, d2j6el1, d2j6el2, d2j6em1
automated match to d1hzhh3
complexed with act, cac, cd, mpd, zn

Details for d2j6ea1

PDB Description: crystal structure of an autoimmune complex between a human igm rheumatoid factor and igg1 fc reveals a novel fc epitope and evidence for affinity maturation

PDB Compounds: (A:) Ig gamma-1 chain C region

SCOPe Domain Sequences for d2j6ea1:

Sequence; same for both SEQRES and ATOM records: (download)

>d2j6ea1 b.1.1.2 (A:236-339) automated matches {Human (Homo sapiens) [TaxId: 9606]}
ggpsvflfppkpkdtlmisrtpevtcvvvdvsheepevkfnwyvdgvevhnaktkpreeq
ynstyrvvsvltvlhqdwlngkeykckvsnkalpapiektiska

SCOPe Domain Coordinates for d2j6ea1:

Click to download the PDB-style file with coordinates for d2j6ea1.
(The format of our PDB-style files is described here.)

Timeline for d2j6ea1: