Lineage for d2j47a3 (2j47 A:4-126)

  1. Root: SCOPe 2.08
  2. 2923792Class d: Alpha and beta proteins (a+b) [53931] (396 folds)
  3. 2963580Fold d.92: Zincin-like [55485] (2 superfamilies)
    contains mixed beta sheet with connection over free side of the sheet
  4. 2965096Superfamily d.92.2: beta-N-acetylhexosaminidase-like domain [55545] (4 families) (S)
    contains similar fold but lacks its catalytic centre
  5. 2965167Family d.92.2.3: Hyaluronidase N-terminal domain-like [143618] (2 proteins)
  6. 2965168Protein Glucosaminidase GH84, N-terminal domain [143621] (1 species)
  7. 2965169Species Bacteroides thetaiotaomicron [TaxId:818] [143622] (8 PDB entries)
    Uniprot Q89ZI2 25-147
  8. 2965174Domain d2j47a3: 2j47 A:4-126 [137993]
    Other proteins in same PDB: d2j47a1, d2j47a2
    complexed with gdv, gol

Details for d2j47a3

PDB Entry: 2j47 (more details), 1.98 Å

PDB Description: bacteroides thetaiotaomicron gh84 o-glcnacase in complex with a imidazole-pugnac hybrid inhibitor
PDB Compounds: (A:) glucosaminidase

SCOPe Domain Sequences for d2j47a3:

Sequence, based on SEQRES records: (download)

>d2j47a3 d.92.2.3 (A:4-126) Glucosaminidase GH84, N-terminal domain {Bacteroides thetaiotaomicron [TaxId: 818]}
slqpppqqlivqnktidlpavyqlnggeeanphavkvlkellsgkqsskkgmlisigekg
dksvrkysrqipdhkegyylsvnekeivlagndergtyyalqtfaqllkdgklpeveikd
yps

Sequence, based on observed residues (ATOM records): (download)

>d2j47a3 d.92.2.3 (A:4-126) Glucosaminidase GH84, N-terminal domain {Bacteroides thetaiotaomicron [TaxId: 818]}
slqpppqqlivqnktidyqlnggeeanphavkvlkellsggmlisigekgdksvrkysrq
ipdhkegyylsvnekeivlagndergtyyalqtfaqllkdgklpeveikdyps

SCOPe Domain Coordinates for d2j47a3:

Click to download the PDB-style file with coordinates for d2j47a3.
(The format of our PDB-style files is described here.)

Timeline for d2j47a3: