Class c: Alpha and beta proteins (a/b) [51349] (148 folds) |
Fold c.37: P-loop containing nucleoside triphosphate hydrolases [52539] (1 superfamily) 3 layers: a/b/a, parallel or mixed beta-sheets of variable sizes |
Superfamily c.37.1: P-loop containing nucleoside triphosphate hydrolases [52540] (25 families) division into families based on beta-sheet topologies |
Family c.37.1.19: Tandem AAA-ATPase domain [81268] (24 proteins) duplication: tandem repeat of two RecA-like (AAA) domains |
Protein automated matches [190301] (5 species) not a true protein |
Species Human (Homo sapiens) [TaxId:9606] [187108] (3 PDB entries) |
Domain d2j0sa2: 2j0s A:244-411 [137914] Other proteins in same PDB: d2j0sc_, d2j0sd_ automated match to d2j0sa2 protein/DNA complex; protein/RNA complex; complexed with anp, mg |
PDB Entry: 2j0s (more details), 2.21 Å
SCOPe Domain Sequences for d2j0sa2:
Sequence; same for both SEQRES and ATOM records: (download)
>d2j0sa2 c.37.1.19 (A:244-411) automated matches {Human (Homo sapiens) [TaxId: 9606]} deltlegikqffvavereewkfdtlcdlydtltitqavifcntkrkvdwltekmreanft vssmhgdmpqkeresimkefrsgasrvlistdvwargldvpqvsliinydlpnnrelyih rigrsgrygrkgvainfvknddirilrdieqyystqidempmnvadli
Timeline for d2j0sa2: