Lineage for d2j0sa1 (2j0s A:21-243)

  1. Root: SCOPe 2.06
  2. 2089713Class c: Alpha and beta proteins (a/b) [51349] (148 folds)
  3. 2123292Fold c.37: P-loop containing nucleoside triphosphate hydrolases [52539] (1 superfamily)
    3 layers: a/b/a, parallel or mixed beta-sheets of variable sizes
  4. 2123293Superfamily c.37.1: P-loop containing nucleoside triphosphate hydrolases [52540] (26 families) (S)
    division into families based on beta-sheet topologies
  5. 2127512Family c.37.1.19: Tandem AAA-ATPase domain [81268] (24 proteins)
    duplication: tandem repeat of two RecA-like (AAA) domains
  6. 2127719Protein automated matches [190301] (5 species)
    not a true protein
  7. 2127725Species Human (Homo sapiens) [TaxId:9606] [187108] (3 PDB entries)
  8. 2127727Domain d2j0sa1: 2j0s A:21-243 [137913]
    Other proteins in same PDB: d2j0sc_, d2j0sd_
    automated match to d2j0sa1
    protein/DNA complex; protein/RNA complex; complexed with anp, mg

Details for d2j0sa1

PDB Entry: 2j0s (more details), 2.21 Å

PDB Description: the crystal structure of the exon junction complex at 2.2 a resolution
PDB Compounds: (A:) ATP-dependent RNA helicase ddx48

SCOPe Domain Sequences for d2j0sa1:

Sequence; same for both SEQRES and ATOM records: (download)

>d2j0sa1 c.37.1.19 (A:21-243) automated matches {Human (Homo sapiens) [TaxId: 9606]}
edmtkvefetseevdvtptfdtmglredllrgiyaygfekpsaiqqraikqiikgrdvia
qsqsgtgktatfsisvlqcldiqvretqalilaptrelavqiqkgllalgdymnvqchac
iggtnvgedirkldygqhvvagtpgrvfdmirrrslrtraikmlvldeademlnkgfkeq
iydvyrylppatqvvlisatlpheilemtnkfmtdpirilvkr

SCOPe Domain Coordinates for d2j0sa1:

Click to download the PDB-style file with coordinates for d2j0sa1.
(The format of our PDB-style files is described here.)

Timeline for d2j0sa1:

View in 3D
Domains from same chain:
(mouse over for more information)
d2j0sa2