Lineage for d2j01c1 (2j01 C:18-224)

  1. Root: SCOP 1.75
  2. 883176Class e: Multi-domain proteins (alpha and beta) [56572] (66 folds)
  3. 885297Fold e.24: Ribosomal protein L1 [56807] (1 superfamily)
    2 domains: (1) alpha+beta; (2) alpha/beta (interrupts domain 1)
  4. 885298Superfamily e.24.1: Ribosomal protein L1 [56808] (1 family) (S)
  5. 885299Family e.24.1.1: Ribosomal protein L1 [56809] (1 protein)
  6. 885300Protein Ribosomal protein L1 [56810] (4 species)
  7. 885311Species Thermus thermophilus [TaxId:274] [56811] (13 PDB entries)
  8. 885318Domain d2j01c1: 2j01 C:18-224 [137861]
    Other proteins in same PDB: d2j0111, d2j0121, d2j0131, d2j0141, d2j0151, d2j0161, d2j0171, d2j0181, d2j01d1, d2j01d2, d2j01e1, d2j01f1, d2j01g1, d2j01h1, d2j01h2, d2j01i1, d2j01i2, d2j01n1, d2j01o1, d2j01p1, d2j01q1, d2j01r1, d2j01s1, d2j01t1, d2j01u1, d2j01v1, d2j01w1, d2j01x1, d2j01y1, d2j01z1

Details for d2j01c1

PDB Entry: 2j01 (more details), 2.8 Å

PDB Description: Structure of the Thermus thermophilus 70S ribosome complexed with mRNA, tRNA and paromomycin (PART 2 of 4). This file contains the 50S subunit from molecule I.
PDB Compounds: (C:) 50s ribosomal protein l1

SCOP Domain Sequences for d2j01c1:

Sequence, based on SEQRES records: (download)

>d2j01c1 e.24.1.1 (C:18-224) Ribosomal protein L1 {Thermus thermophilus [TaxId: 274]}
kvytideaarlvkelatakfdetvevhaklgidprrsdqnvrgtvslphglgkqvrvlai
akgekikeaeeagadyvggeeiiqkildgwmdfdavvatpdvmgavgsklgrilgprgll
pnpkagtvgfnigeiireikagriefrndktgaihapvgkasfppekladnirafirale
ahkpegakgtflrsvyvtttmgpsvri

Sequence, based on observed residues (ATOM records): (download)

>d2j01c1 e.24.1.1 (C:18-224) Ribosomal protein L1 {Thermus thermophilus [TaxId: 274]}
kvytideaartakfdetvevhaklgidprrsdqnvrgtvslphglgkqvrvlaiakgeki
keaeeagadyvggeeiiqkildgwmdfvmgavgsklgrilgprglnpkagtvgfnigeii
reikagriefrndktgaihapvgkasfppekladnirafiraleahkpegakgtflrsvy
vtttmgpsvri

SCOP Domain Coordinates for d2j01c1:

Click to download the PDB-style file with coordinates for d2j01c1.
(The format of our PDB-style files is described here.)

Timeline for d2j01c1: