Lineage for d2izza2 (2izz A:165-271)

  1. Root: SCOPe 2.06
  2. 1976409Class a: All alpha proteins [46456] (289 folds)
  3. 2006475Fold a.100: 6-phosphogluconate dehydrogenase C-terminal domain-like [48178] (1 superfamily)
    multihelical; common core is formed around two long antiparallel helices related by (pseudo) twofold symmetry
  4. 2006476Superfamily a.100.1: 6-phosphogluconate dehydrogenase C-terminal domain-like [48179] (13 families) (S)
    N-terminal domain is Rossmann-fold with a family-specific C-terminal extension
  5. 2006685Family a.100.1.0: automated matches [227147] (1 protein)
    not a true family
  6. 2006686Protein automated matches [226851] (35 species)
    not a true protein
  7. 2006765Species Human (Homo sapiens) [TaxId:9606] [225061] (18 PDB entries)
  8. 2006766Domain d2izza2: 2izz A:165-271 [230876]
    Other proteins in same PDB: d2izza1, d2izza3, d2izzb1, d2izzb3, d2izzc1, d2izzc3, d2izzd1, d2izzd3, d2izze1
    automated match to d2rcya2
    complexed with edo, nad

Details for d2izza2

PDB Entry: 2izz (more details), 1.95 Å

PDB Description: crystal structure of human pyrroline-5-carboxylate reductase
PDB Compounds: (A:) Pyrroline-5-carboxylate reductase 1

SCOPe Domain Sequences for d2izza2:

Sequence; same for both SEQRES and ATOM records: (download)

>d2izza2 a.100.1.0 (A:165-271) automated matches {Human (Homo sapiens) [TaxId: 9606]}
dlidavtglsgsgpayaftaldaladggvkmglprrlavrlgaqallgaakmllhseqhp
gqlkdnvsspggatihalhvlesggfrsllinaveascirtrelqsm

SCOPe Domain Coordinates for d2izza2:

Click to download the PDB-style file with coordinates for d2izza2.
(The format of our PDB-style files is described here.)

Timeline for d2izza2: