Lineage for d2iynb_ (2iyn B:)

  1. Root: SCOPe 2.03
  2. 1336837Class c: Alpha and beta proteins (a/b) [51349] (147 folds)
  3. 1356042Fold c.23: Flavodoxin-like [52171] (15 superfamilies)
    3 layers, a/b/a; parallel beta-sheet of 5 strand, order 21345
  4. 1356043Superfamily c.23.1: CheY-like [52172] (8 families) (S)
  5. 1356044Family c.23.1.1: CheY-related [52173] (26 proteins)
  6. 1356316Protein automated matches [190177] (7 species)
    not a true protein
  7. 1356337Species Escherichia coli [TaxId:562] [186909] (4 PDB entries)
  8. 1356346Domain d2iynb_: 2iyn B: [137804]
    automated match to d1b00a_
    complexed with mg

Details for d2iynb_

PDB Entry: 2iyn (more details), 2.08 Å

PDB Description: the co-factor-induced pre-active conformation in phob
PDB Compounds: (B:) phosphate regulon transcriptional regulatory protein phob

SCOPe Domain Sequences for d2iynb_:

Sequence; same for both SEQRES and ATOM records: (download)

>d2iynb_ c.23.1.1 (B:) automated matches {Escherichia coli [TaxId: 562]}
marrilvvedeapiremvcfvleqngfqpveaedydsavnqlnepwpdlilldwmlpggs
giqfikhlkresmtrdipvvmltargeeedrvrgletgaddyitkpfspkelvarikavm
rris

SCOPe Domain Coordinates for d2iynb_:

Click to download the PDB-style file with coordinates for d2iynb_.
(The format of our PDB-style files is described here.)

Timeline for d2iynb_: