Lineage for d2ixka_ (2ixk A:)
- Root: SCOPe 2.08
Class b: All beta proteins [48724] (180 folds) 
Fold b.82: Double-stranded beta-helix [51181] (7 superfamilies)
one turn of helix is made by two pairs of antiparallel strands linked with short turns
has appearance of a sandwich of distinct architecture and jelly-roll topologySuperfamily b.82.1: RmlC-like cupins [51182] (25 families) 
Family b.82.1.1: dTDP-sugar isomerase [51183] (5 proteins) Protein dTDP-4-dehydrorhamnose 3,5-epimerase RmlC [51184] (6 species)
synonym: dTDP-6-deoxy-D-xylo-4-hexulose 3,5-epimerase
Species Pseudomonas aeruginosa [TaxId:287] [101972] (5 PDB entries) 
Domain d2ixka_: 2ixk A: [165739]
automated match to d1rtva_
complexed with tdo
Details for d2ixka_
PDB Entry: 2ixk (more details), 1.7 Å
PDB Description: rmlc p aeruginosa with dtdp-4-keto rhamnnose (the product of the reaction)
PDB Compounds: (A:) dtdp-4-dehydrorhamnose 3,5-epimeraseSCOPe Domain Sequences for d2ixka_:
Sequence; same for both SEQRES and ATOM records: (download)
>d2ixka_ b.82.1.1 (A:) dTDP-4-dehydrorhamnose 3,5-epimerase RmlC {Pseudomonas aeruginosa [TaxId: 287]}
smsmkatrlaipdvilfeprvfgddrgfffesynqrafeeacghpvsfvqdnhsrsargv
lrglhyqirqaqgklvratlgevfdvavdlrrgsptfgqwvgerlsaenkrqmwipagfa
hgfvvlseyaeflykttdfwapehercivwndpelkidwplqdapllsekdrqgkafada
dcfp
SCOPe Domain Coordinates for d2ixka_:
Click to download the PDB-style file with coordinates for d2ixka_.
(The format of our PDB-style files is described here.)
(The format of our PDB-style files is described here.)
Timeline for d2ixka_:
- d2ixka_ first appeared in SCOPe 2.01
- d2ixka_ appears in SCOPe 2.07
View in 3D
