Lineage for d2iv0a_ (2iv0 A:)

  1. Root: SCOPe 2.08
  2. 2826024Class c: Alpha and beta proteins (a/b) [51349] (148 folds)
  3. 2905791Fold c.77: Isocitrate/Isopropylmalate dehydrogenase-like [53658] (1 superfamily)
    consists of two intertwined (sub)domains related by pseudo dyad; duplication
    3 layers: a/b/a; single mixed beta-sheet of 10 strands, order 213A945867 (A=10); strands from 5 to 9 are antiparallel to the rest
  4. 2905792Superfamily c.77.1: Isocitrate/Isopropylmalate dehydrogenase-like [53659] (6 families) (S)
    the constituent families form similar dimers
  5. 2905793Family c.77.1.1: Dimeric isocitrate & isopropylmalate dehydrogenases [53660] (4 proteins)
    the active site is between the two identical subunits
  6. 2905990Protein automated matches [190072] (22 species)
    not a true protein
  7. 2905996Species Archaeoglobus fulgidus [TaxId:2234] [187335] (1 PDB entry)
  8. 2905997Domain d2iv0a_: 2iv0 A: [165706]
    automated match to d1ai2a_
    complexed with cl, zn

Details for d2iv0a_

PDB Entry: 2iv0 (more details), 2.5 Å

PDB Description: thermal stability of isocitrate dehydrogenase from archaeoglobus fulgidus studied by crystal structure analysis and engineering of chimers
PDB Compounds: (A:) isocitrate dehydrogenase

SCOPe Domain Sequences for d2iv0a_:

Sequence; same for both SEQRES and ATOM records: (download)

>d2iv0a_ c.77.1.1 (A:) automated matches {Archaeoglobus fulgidus [TaxId: 2234]}
mqyekvkppengekiryengklivpdnpiipyfegdgigkdvvpaairvldaaadkigke
vvwfqvyagedayklygnylpddtlnaikefrvalkgplttpvgggyrslnvtirqvldl
yanvrpvyylkgvpspikhpekvnfvifrentedvyagiewprgseealklirflknefg
vtiredsgigikpisefatkrlvrmairyaiennrksvtlvhkgnimkytegafrdwgye
vakqefgeycitedelwdkyggkqpegkivvkdriadnmfqqiltrtdeydvialpnlng
dylsdaaaaligglgiapgsnigdgigvfepvhgsapkyagqnkvnptaeiltgalmfey
igwkdasemikkavemtissgivtydihrhmggtkvgtrefaeavvenlqsl

SCOPe Domain Coordinates for d2iv0a_:

Click to download the PDB-style file with coordinates for d2iv0a_.
(The format of our PDB-style files is described here.)

Timeline for d2iv0a_: