Lineage for d2isha_ (2ish A:)
- Root: SCOPe 2.07
Class d: Alpha and beta proteins (a+b) [53931] (388 folds) 
Fold d.92: Zincin-like [55485] (2 superfamilies)
contains mixed beta sheet with connection over free side of the sheetSuperfamily d.92.1: Metalloproteases ("zincins"), catalytic domain [55486] (18 families) 
Family d.92.1.7: Clostridium neurotoxins, catalytic domain [55512] (2 proteins) Protein automated matches [190410] (2 species)
not a true proteinSpecies Clostridium botulinum [TaxId:1491] [187385] (26 PDB entries) 
Domain d2isha_: 2ish A: [165674]
automated match to d1xtfa_
complexed with zn
Details for d2isha_
PDB Entry: 2ish (more details), 2 Å
PDB Description: Botulinum Neurotoxin A Light Chain WT Crystal Form C
PDB Compounds: (A:) Neurotoxin BoNT/ASCOPe Domain Sequences for d2isha_:
Sequence; same for both SEQRES and ATOM records: (download)
>d2isha_ d.92.1.7 (A:) automated matches {Clostridium botulinum [TaxId: 1491]}
pfvnkqfnykdpvngvdiayikipnagqmqpvkafkihnkiwviperdtftnpeegdlnp
ppeakqvpvsyydstylstdnekdnylkgvtklferiystdlgrmlltsivrgipfwggs
tidtelkvidtncinviqpdgsyrseelnlviigpsadiiqfecksfghevlnltrngyg
stqyirfspdftfgfeeslevdtnpllgagkfatdpavtlahelihaghrlygiainpnr
vfkvntnayyemsglevsfeelrtfgghdakfidslqenefrlyyynkfkdiastlnkak
sivgttaslqymknvfkekyllsedtsgkfsvdklkfdklykmlteiytednfvkffkvl
nrktylnfdkavfkinivpkvnytiydgfnlrntnlaanfngqnteinnmnftklk
SCOPe Domain Coordinates for d2isha_:
Click to download the PDB-style file with coordinates for d2isha_.
(The format of our PDB-style files is described here.)
(The format of our PDB-style files is described here.)
Timeline for d2isha_:
- d2isha_ first appeared in SCOPe 2.01
- d2isha_ appears in SCOPe 2.06
- d2isha_ appears in the current release, SCOPe 2.08
View in 3D
