Lineage for d2ioya_ (2ioy A:)
- Root: SCOPe 2.08
Class c: Alpha and beta proteins (a/b) [51349] (148 folds) 
Fold c.93: Periplasmic binding protein-like I [53821] (1 superfamily)
consists of two similar intertwined domain with 3 layers (a/b/a) each: duplication
parallel beta-sheet of 6 strands, order 213456Superfamily c.93.1: Periplasmic binding protein-like I [53822] (2 families) 
Similar in architecture to the superfamily II but partly differs in topologyFamily c.93.1.1: L-arabinose binding protein-like [53823] (18 proteins)
has additional insertions and/or extensions that are not grouped together
Protein automated matches [190296] (11 species)
not a true protein
Species Thermoanaerobacter tengcongensis [TaxId:119072] [187869] (1 PDB entry) 
Domain d2ioya_: 2ioy A: [165628]
automated match to d1urpa_
complexed with rip
Details for d2ioya_
PDB Entry: 2ioy (more details), 1.9 Å
PDB Description: crystal structure of thermoanaerobacter tengcongensis ribose binding protein
PDB Compounds: (A:) Periplasmic sugar-binding proteinSCOPe Domain Sequences for d2ioya_:
Sequence; same for both SEQRES and ATOM records: (download)
>d2ioya_ c.93.1.1 (A:) automated matches {Thermoanaerobacter tengcongensis [TaxId: 119072]}
ktiglvistlnnpffvtlkngaeekakelgykiivedsqndsskelsnvedliqqkvdvl
linpvdsdavvtaikeansknipvitidrsanggdvvchiasdnvkggemaaefiakalk
gkgnvvelegipgasaardrgkgfdeaiakypdikivakqaadfdrskglsvmenilqaq
pkidavfaqndemalgaikaieaanrqgiivvgfdgtedalkaikegkmaatiaqqpalm
gslgvemadkylkgekipnfipaelklitkenvq
SCOPe Domain Coordinates for d2ioya_:
Click to download the PDB-style file with coordinates for d2ioya_.
(The format of our PDB-style files is described here.)
(The format of our PDB-style files is described here.)
Timeline for d2ioya_:
- d2ioya_ first appeared in SCOPe 2.01
- d2ioya_ appears in SCOPe 2.07
View in 3D
