Lineage for d2io0b_ (2io0 B:)
- Root: SCOPe 2.05
Class d: Alpha and beta proteins (a+b) [53931] (381 folds) 
Fold d.15: beta-Grasp (ubiquitin-like) [54235] (14 superfamilies)
core: beta(2)-alpha-beta(2); mixed beta-sheet 2143
Superfamily d.15.1: Ubiquitin-like [54236] (9 families) 
Family d.15.1.1: Ubiquitin-related [54237] (39 proteins)
Pfam PF00240Protein SUMO-2 [117816] (1 species) Species Human (Homo sapiens) [TaxId:9606] [117817] (9 PDB entries)
Uniprot P61956
Domain d2io0b_: 2io0 B: [137536]
Other proteins in same PDB: d2io0a1
automated match to d1wm2a_
complexed with so4
Details for d2io0b_
PDB Entry: 2io0 (more details), 2.3 Å
PDB Description: crystal structure of human senp2 in complex with presumo-2
PDB Compounds: (B:) Small ubiquitin-related modifier 2 precursorSCOPe Domain Sequences for d2io0b_:
Sequence; same for both SEQRES and ATOM records: (download)
>d2io0b_ d.15.1.1 (B:) SUMO-2 {Human (Homo sapiens) [TaxId: 9606]}
dhinlkvagqdgsvvqfkikrhtplsklmkaycerqglsmrqirfrfdgqpinetdtpaq
lemededtidvfqqqtggvylehh
SCOPe Domain Coordinates for d2io0b_:
Click to download the PDB-style file with coordinates for d2io0b_.
(The format of our PDB-style files is described here.)
(The format of our PDB-style files is described here.)
Timeline for d2io0b_:
- d2io0b_ first appeared in SCOP 1.73, called d2io0b1
- d2io0b_ appears in SCOPe 2.04
- d2io0b_ is called d2io0b2 in SCOPe 2.06
- d2io0b_ appears in the current release, SCOPe 2.08, called d2io0b2
View in 3D
