Class d: Alpha and beta proteins (a+b) [53931] (381 folds) |
Fold d.15: beta-Grasp (ubiquitin-like) [54235] (14 superfamilies) core: beta(2)-alpha-beta(2); mixed beta-sheet 2143 |
Superfamily d.15.1: Ubiquitin-like [54236] (9 families) |
Family d.15.1.1: Ubiquitin-related [54237] (39 proteins) Pfam PF00240 |
Protein SUMO-2 [117816] (1 species) |
Species Human (Homo sapiens) [TaxId:9606] [117817] (9 PDB entries) Uniprot P61956 |
Domain d2io0b_: 2io0 B: [137536] Other proteins in same PDB: d2io0a1 automated match to d1wm2a_ complexed with so4 |
PDB Entry: 2io0 (more details), 2.3 Å
SCOPe Domain Sequences for d2io0b_:
Sequence; same for both SEQRES and ATOM records: (download)
>d2io0b_ d.15.1.1 (B:) SUMO-2 {Human (Homo sapiens) [TaxId: 9606]} dhinlkvagqdgsvvqfkikrhtplsklmkaycerqglsmrqirfrfdgqpinetdtpaq lemededtidvfqqqtggvylehh
Timeline for d2io0b_: