Lineage for d2io0a1 (2io0 A:364-589)
- Root: SCOPe 2.04
Class d: Alpha and beta proteins (a+b) [53931] (380 folds) 
Fold d.3: Cysteine proteinases [54000] (1 superfamily)
consists of one alpha-helix and 4 strands of antiparallel beta-sheet and contains the catalytic triad Cys-His-AsnSuperfamily d.3.1: Cysteine proteinases [54001] (23 families) 
the constitute families differ by insertion into and circular permutation of the common catalytic core made of one alpha-helix and 3-strands of beta-sheet
Family d.3.1.7: Adenain-like [54054] (6 proteins)
Pfam PF02902; Ulp1 protease family
Protein Sentrin-specific protease 2, SENP2 [110771] (1 species) Species Human (Homo sapiens) [TaxId:9606] [110772] (6 PDB entries)
Uniprot Q9HC62 366-589
Domain d2io0a1: 2io0 A:364-589 [145530]
Other proteins in same PDB: d2io0b_
complexed with so4
Details for d2io0a1
PDB Entry: 2io0 (more details), 2.3 Å
PDB Description: crystal structure of human senp2 in complex with presumo-2
PDB Compounds: (A:) Sentrin-specific protease 2SCOPe Domain Sequences for d2io0a1:
Sequence; same for both SEQRES and ATOM records: (download)
>d2io0a1 d.3.1.7 (A:364-589) Sentrin-specific protease 2, SENP2 {Human (Homo sapiens) [TaxId: 9606]}
dlleltedmekeisnalghgpqdeilssafklritrgdiqtlknyhwlndevinfymnll
vernkkqgypalhvfstffypklksggyqavkrwtkgvnlfeqeiilvpihrkvhwslvv
idlrkkclkyldsmgqkghriceillqylqdesktkrnsdlnllewthhsmkpheipqql
ngsdsgmftckyadyisrdkpitftqhqmplfrkkmvweilhqqll
SCOPe Domain Coordinates for d2io0a1:
Click to download the PDB-style file with coordinates for d2io0a1.
(The format of our PDB-style files is described here.)
(The format of our PDB-style files is described here.)
Timeline for d2io0a1:
- d2io0a1 first appeared in SCOP 1.75
- d2io0a1 appears in SCOPe 2.03
- d2io0a1 appears in SCOPe 2.05
- d2io0a1 appears in the current release, SCOPe 2.08
View in 3D
