Class a: All alpha proteins [46456] (226 folds) |
Fold a.26: 4-helical cytokines [47265] (1 superfamily) core: 4 helices; bundle, closed; left-handed twist; 2 crossover connections |
Superfamily a.26.1: 4-helical cytokines [47266] (3 families) there are two different topoisomers of this fold with different entanglements of the two crossover connections |
Family a.26.1.3: Interferons/interleukin-10 (IL-10) [47305] (8 proteins) contains an additional helix in one of the crossover connections |
Protein Interleukin-10 (cytokine synthesis inhibitory factor, CSIF) [47306] (3 species) intertwined dimer, similar to interferon-gamma |
Species Human (Homo sapiens) [TaxId:9606] [47307] (5 PDB entries) |
Domain d2ilk__: 2ilk - [16885] complexed with so4 |
PDB Entry: 2ilk (more details), 1.6 Å
SCOP Domain Sequences for d2ilk__:
Sequence; same for both SEQRES and ATOM records: (download)
>d2ilk__ a.26.1.3 (-) Interleukin-10 (cytokine synthesis inhibitory factor, CSIF) {Human (Homo sapiens)} tqsenscthfpgnlpnmlrdlrdafsrvktffqmkdqldnlllkeslledfkgylgcqal semiqfyleevmpqaenqdpdikahvnslgenlktlrlrlrrchrflpcenkskaveqvk nafnklqekgiykamsefdifinyieaymtmkirn
Timeline for d2ilk__: