Lineage for d2ik0b_ (2ik0 B:)
- Root: SCOPe 2.08
Class b: All beta proteins [48724] (180 folds) 
Fold b.40: OB-fold [50198] (17 superfamilies)
barrel, closed or partly opened n=5, S=10 or S=8; greek-key
Superfamily b.40.5: Inorganic pyrophosphatase [50324] (2 families) 
Family b.40.5.1: Inorganic pyrophosphatase [50325] (2 proteins)
barrel, closed; n=5, S=8Protein Inorganic pyrophosphatase [50326] (9 species)
eukaryotic enzyme has additional secondary structures at both N- and C-termini
Species Baker's yeast (Saccharomyces cerevisiae) [TaxId:4932] [50327] (19 PDB entries) 
Domain d2ik0b_: 2ik0 B: [165591]
automated match to d1e6aa_
complexed with mg, mpd, po4
has additional insertions and/or extensions that are not grouped together
Details for d2ik0b_
PDB Entry: 2ik0 (more details), 1.7 Å
PDB Description: yeast inorganic pyrophosphatase variant e48d with magnesium and phosphate
PDB Compounds: (B:) inorganic pyrophosphataseSCOPe Domain Sequences for d2ik0b_:
Sequence; same for both SEQRES and ATOM records: (download)
>d2ik0b_ b.40.5.1 (B:) Inorganic pyrophosphatase {Baker's yeast (Saccharomyces cerevisiae) [TaxId: 4932]}
tyttrqigakntleykvyiekdgkpvsafhdiplyadkennifnmvvdiprwtnakleit
keetlnpiiqdtkkgklrfvrncfphhgyihnygafpqtwedpnvshpetkavgdndpid
vleigetiaytgqvkqvkalgimalldegetdwkviaidindplapklndiedvekyfpg
llratnewfriykipdgkpenqfafsgeaknkkyaldiikethdswkqliagkssdskgi
dltnvtlpdtptyskaasdaippaslkadapidksidkwffisgsv
SCOPe Domain Coordinates for d2ik0b_:
Click to download the PDB-style file with coordinates for d2ik0b_.
(The format of our PDB-style files is described here.)
(The format of our PDB-style files is described here.)
Timeline for d2ik0b_:
- d2ik0b_ first appeared in SCOPe 2.01
- d2ik0b_ appears in SCOPe 2.07
View in 3D
