Lineage for d2ijob1 (2ijo B:5-176)
- Root: SCOPe 2.05
Class b: All beta proteins [48724] (176 folds) 
Fold b.47: Trypsin-like serine proteases [50493] (1 superfamily)
barrel, closed; n=6, S=8; greek-key
duplication: consists of two domains of the same foldSuperfamily b.47.1: Trypsin-like serine proteases [50494] (5 families) 
Family b.47.1.3: Viral proteases [50596] (5 proteins)
beta sheet in the first domain is opened rather than forms a barrel
Protein NS3 protease [50600] (5 species) 
Species West Nile virus [TaxId:11082] [141386] (2 PDB entries)
Uniprot P06935 1520-1671
Domain d2ijob1: 2ijo B:5-176 [145527]
Other proteins in same PDB: d2ijoi_
complexed with NS2B cofactor, chain A
Details for d2ijob1
PDB Entry: 2ijo (more details), 2.3 Å
PDB Description: crystal structure of the west nile virus ns2b-ns3 protease complexed with bovine pancreatic trypsin inhibitor
PDB Compounds: (B:) PolyproteinSCOPe Domain Sequences for d2ijob1:
Sequence, based on SEQRES records: (download)
>d2ijob1 b.47.1.3 (B:5-176) NS3 protease {West Nile virus [TaxId: 11082]}
wdtpspkeykkgdtttgvyrimtrgllgsyqagagvmvegvfhtlwhttkgaalmsgegr
ldpywgsvkedrlcyggpwqlqhkwngqdevqmivvepgrnvknvqtkpgvfktpegeig
avtldfptgtsgspivdkngdviglygngvimpngsyisaivqgermdepip
Sequence, based on observed residues (ATOM records): (download)
>d2ijob1 b.47.1.3 (B:5-176) NS3 protease {West Nile virus [TaxId: 11082]}
wkkgdtttgvyrimtrgllgsyqagagvmvegvfhtlwhttkgaalmsgegrldpywgsv
kedrlcyggpwqlqhkwngqdevqmivvepgrnvknvqtkpgvfktpegeigavtldfpt
gtsgspivdkngdviglygngvimpngsyisaivqgermdepip
SCOPe Domain Coordinates for d2ijob1:
Click to download the PDB-style file with coordinates for d2ijob1.
(The format of our PDB-style files is described here.)
(The format of our PDB-style files is described here.)
Timeline for d2ijob1:
- d2ijob1 first appeared in SCOP 1.75
- d2ijob1 appears in SCOPe 2.04
- d2ijob1 appears in SCOPe 2.06
- d2ijob1 appears in the current release, SCOPe 2.08
View in 3D
