Lineage for d2ihoa2 (2iho A:156-293)
- Root: SCOPe 2.05
Class d: Alpha and beta proteins (a+b) [53931] (381 folds) 
Fold d.3: Cysteine proteinases [54000] (1 superfamily)
consists of one alpha-helix and 4 strands of antiparallel beta-sheet and contains the catalytic triad Cys-His-AsnSuperfamily d.3.1: Cysteine proteinases [54001] (23 families) 
the constitute families differ by insertion into and circular permutation of the common catalytic core made of one alpha-helix and 3-strands of beta-sheet
Family d.3.1.18: MOA C-terminal domain-like [159846] (1 protein)
PfamB PB070855Protein Agglutinin MOA [159847] (1 species) Species Fairy-ring mushroom (Marasmius oreades) [TaxId:181124] [159848] (2 PDB entries)
Uniprot Q8X123 156-293
Domain d2ihoa2: 2iho A:156-293 [147682]
Other proteins in same PDB: d2ihoa1
Details for d2ihoa2
PDB Entry: 2iho (more details), 2.41 Å
PDB Description: crystal structure of moa, a lectin from the mushroom marasmius oreades in complex with the trisaccharide gal(1,3)gal(1,4)glcnac
PDB Compounds: (A:) lectinSCOPe Domain Sequences for d2ihoa2:
Sequence; same for both SEQRES and ATOM records: (download)
>d2ihoa2 d.3.1.18 (A:156-293) Agglutinin MOA {Fairy-ring mushroom (Marasmius oreades) [TaxId: 181124]}
msvssaeaqaaiarnphihgtyrgyildgeylvlpnatftqiwkdsglpgskwreqiydc
ddfaiamkaavgkwgadswkangfaifcgvmlgvnkagdaahaynftltkdhadivffep
qnggylndigydsymafy
SCOPe Domain Coordinates for d2ihoa2:
Click to download the PDB-style file with coordinates for d2ihoa2.
(The format of our PDB-style files is described here.)
(The format of our PDB-style files is described here.)
Timeline for d2ihoa2:
- d2ihoa2 first appeared in SCOP 1.75
- d2ihoa2 appears in SCOPe 2.04
- d2ihoa2 appears in SCOPe 2.06
- d2ihoa2 appears in the current release, SCOPe 2.08
View in 3D
