Lineage for d2i7fa_ (2i7f A:)
- Root: SCOPe 2.08
Class b: All beta proteins [48724] (180 folds) 
Fold b.33: ISP domain [50021] (1 superfamily)
consists of two all-beta subdomains: conserved small domain has a rubredoxin-like fold; larger domain consists of 6 beta-stands packed in either sandwich of two 3-stranded sheets or closed barrel (n=6; S=8)Superfamily b.33.1: ISP domain [50022] (4 families) 
Family b.33.1.0: automated matches [191455] (1 protein)
not a true familyProtein automated matches [190701] (13 species)
not a true protein
Species Sphingobium yanoikuyae [TaxId:13690] [187845] (3 PDB entries) 
Domain d2i7fa_: 2i7f A: [165422]
automated match to d1fqta_
complexed with cit, fes, so4
Details for d2i7fa_
PDB Entry: 2i7f (more details), 1.9 Å
PDB Description: sphingomonas yanoikuyae b1 ferredoxin
PDB Compounds: (A:) Ferredoxin component of dioxygenaseSCOPe Domain Sequences for d2i7fa_:
Sequence; same for both SEQRES and ATOM records: (download)
>d2i7fa_ b.33.1.0 (A:) automated matches {Sphingobium yanoikuyae [TaxId: 13690]}
nklrlcqvasvkdgepvavyqekmpalavynvdgevfvtdnlcthgnamltdgyqdgtii
ecpfhggsfdiatgaakafpcqipiktypvtiedgwvcidqp
SCOPe Domain Coordinates for d2i7fa_:
Click to download the PDB-style file with coordinates for d2i7fa_.
(The format of our PDB-style files is described here.)
(The format of our PDB-style files is described here.)
Timeline for d2i7fa_:
- d2i7fa_ first appeared in SCOPe 2.01
- d2i7fa_ appears in SCOPe 2.07
View in 3D
