Lineage for d2i53a1 (2i53 A:14-157)
- Root: SCOPe 2.06
Class a: All alpha proteins [46456] (289 folds) 
Fold a.74: Cyclin-like [47953] (1 superfamily)
core: 5 helices; one helix is surrounded by the othersSuperfamily a.74.1: Cyclin-like [47954] (4 families) 
duplication: consists of two domains of this foldFamily a.74.1.1: Cyclin [47955] (9 proteins) Protein Cyclin K [158591] (1 species) Species Human (Homo sapiens) [TaxId:9606] [158592] (1 PDB entry)
Uniprot O75909 14-157! Uniprot O75909 158-267
Domain d2i53a1: 2i53 A:14-157 [147505]
complexed with act
Details for d2i53a1
PDB Entry: 2i53 (more details), 1.5 Å
PDB Description: Crystal structure of Cyclin K
PDB Compounds: (A:) Cyclin KSCOPe Domain Sequences for d2i53a1:
Sequence; same for both SEQRES and ATOM records: (download)
>d2i53a1 a.74.1.1 (A:14-157) Cyclin K {Human (Homo sapiens) [TaxId: 9606]}
sanldhtkpcwywdkkdlahtpsqlegldpatearyrregarfifdvgtrlglhydtlat
giiyfhrfymfhsfkqfpryvtgacclflagkveetpkkckdiiktarsllndvqfgqfg
ddpkeevmvlerillqtikfdlqv
SCOPe Domain Coordinates for d2i53a1:
Click to download the PDB-style file with coordinates for d2i53a1.
(The format of our PDB-style files is described here.)
(The format of our PDB-style files is described here.)
Timeline for d2i53a1:
- d2i53a1 first appeared in SCOP 1.75
- d2i53a1 appears in SCOPe 2.05
- d2i53a1 appears in SCOPe 2.07
- d2i53a1 appears in the current release, SCOPe 2.08
View in 3D
