Lineage for d2i26o_ (2i26 O:)
- Root: SCOPe 2.05
Class b: All beta proteins [48724] (176 folds) 
Fold b.1: Immunoglobulin-like beta-sandwich [48725] (31 superfamilies)
sandwich; 7 strands in 2 sheets; greek-key
some members of the fold have additional strands
Superfamily b.1.1: Immunoglobulin [48726] (5 families) 
Family b.1.1.1: V set domains (antibody variable domain-like) [48727] (33 proteins) Protein automated matches [190119] (18 species)
not a true protein
Species Nurse shark (Ginglymostoma cirratum) [TaxId:7801] [187220] (4 PDB entries) 
Domain d2i26o_: 2i26 O: [145418]
Other proteins in same PDB: d2i26l_, d2i26m_, d2i26n1, d2i26q_
automated match to d2i26n1
complexed with so4
Details for d2i26o_
PDB Entry: 2i26 (more details), 2.5 Å
PDB Description: Crystal structure analysis of the nurse shark new antigen receptor ancestral variable domain in complex with lysozyme
PDB Compounds: (O:) New Antigen Receptor AncestralSCOPe Domain Sequences for d2i26o_:
Sequence; same for both SEQRES and ATOM records: (download)
>d2i26o_ b.1.1.1 (O:) automated matches {Nurse shark (Ginglymostoma cirratum) [TaxId: 7801]}
rvdqtpqtitketgesltincvlrdsncalsstywyrkksgstneesiskggryvetvns
gsksfslrindltvedsgtyrckpesrygsydaecaalndqygggtvvtvnaaahhh
SCOPe Domain Coordinates for d2i26o_:
Click to download the PDB-style file with coordinates for d2i26o_.
(The format of our PDB-style files is described here.)
(The format of our PDB-style files is described here.)
Timeline for d2i26o_:
- d2i26o_ first appeared in SCOP 1.75, called d2i26o1
- d2i26o_ appears in SCOPe 2.04
- d2i26o_ is called d2i26o2 in SCOPe 2.06
- d2i26o_ appears in the current release, SCOPe 2.08, called d2i26o2
View in 3D
