Lineage for d2hzca_ (2hzc A:)

  1. Root: SCOPe 2.05
  2. 1886641Class d: Alpha and beta proteins (a+b) [53931] (381 folds)
  3. 1906287Fold d.58: Ferredoxin-like [54861] (59 superfamilies)
    alpha+beta sandwich with antiparallel beta-sheet; (beta-alpha-beta)x2
  4. 1908438Superfamily d.58.7: RNA-binding domain, RBD [54928] (6 families) (S)
  5. 1908439Family d.58.7.1: Canonical RBD [54929] (68 proteins)
  6. 1908828Protein Splicing factor U2AF 65 KDa subunit [54936] (2 species)
  7. 1908829Species Human (Homo sapiens) [TaxId:9606] [54937] (7 PDB entries)
  8. 1908830Domain d2hzca_: 2hzc A: [165337]
    automated match to d1u2fa_
    complexed with p6g, zn

Details for d2hzca_

PDB Entry: 2hzc (more details), 1.47 Å

PDB Description: Crystal structure of the N-terminal RRM of the U2AF large subunit
PDB Compounds: (A:) splicing factor u2af 65 kda subunit

SCOPe Domain Sequences for d2hzca_:

Sequence; same for both SEQRES and ATOM records: (download)

>d2hzca_ d.58.7.1 (A:) Splicing factor U2AF 65 KDa subunit {Human (Homo sapiens) [TaxId: 9606]}
gplgsarrlyvgnipfgiteeammdffnaqmrlggltqapgnpvlavqinqdknfaflef
rsvdettqamafdgiifqgqslkirrp

SCOPe Domain Coordinates for d2hzca_:

Click to download the PDB-style file with coordinates for d2hzca_.
(The format of our PDB-style files is described here.)

Timeline for d2hzca_: