Lineage for d2hvyc1 (2hvy C:3-55)

  1. Root: SCOPe 2.03
  2. 1458801Class g: Small proteins [56992] (90 folds)
  3. 1464002Fold g.41: Rubredoxin-like [57769] (17 superfamilies)
    metal(zinc or iron)-bound fold; sequence contains two CX(n)C motifs, in most cases n = 2
  4. 1464902Superfamily g.41.16: Nop10-like SnoRNP [144210] (1 family) (S)
    automatically mapped to Pfam PF04135
  5. 1464903Family g.41.16.1: Nucleolar RNA-binding protein Nop10-like [144211] (3 proteins)
    Pfam PF04135; contains N-terminal zinc-finger domain similar to the insert finger of the Initiation factor eIF2 gamma subunit (75204)
  6. 1464909Protein Ribosome biogenesis protein Nop10 [144214] (2 species)
  7. 1464913Species Pyrococcus furiosus [TaxId:2261] [144215] (10 PDB entries)
    Uniprot Q8U1R4 4-55
  8. 1464918Domain d2hvyc1: 2hvy C:3-55 [145412]
    Other proteins in same PDB: d2hvya1, d2hvya2, d2hvyb1, d2hvyd1
    protein/RNA complex; complexed with atp, zn

Details for d2hvyc1

PDB Entry: 2hvy (more details), 2.3 Å

PDB Description: crystal structure of an h/aca box rnp from pyrococcus furiosus
PDB Compounds: (C:) Ribosome biogenesis protein Nop10

SCOPe Domain Sequences for d2hvyc1:

Sequence; same for both SEQRES and ATOM records: (download)

>d2hvyc1 g.41.16.1 (C:3-55) Ribosome biogenesis protein Nop10 {Pyrococcus furiosus [TaxId: 2261]}
frirkcpkcgrytlkevcpvcgektkvahpprfspedpygeyrrrwkrevlgi

SCOPe Domain Coordinates for d2hvyc1:

Click to download the PDB-style file with coordinates for d2hvyc1.
(The format of our PDB-style files is described here.)

Timeline for d2hvyc1: