Lineage for d2hunb_ (2hun B:)
- Root: SCOPe 2.08
Class c: Alpha and beta proteins (a/b) [51349] (148 folds) 
Fold c.2: NAD(P)-binding Rossmann-fold domains [51734] (1 superfamily)
core: 3 layers, a/b/a; parallel beta-sheet of 6 strands, order 321456
The nucleotide-binding modes of this and the next two folds/superfamilies are similarSuperfamily c.2.1: NAD(P)-binding Rossmann-fold domains [51735] (13 families) 
Family c.2.1.0: automated matches [191313] (1 protein)
not a true familyProtein automated matches [190069] (319 species)
not a true protein
Species Pyrococcus horikoshii OT3 [TaxId:70601] [187049] (1 PDB entry) 
Domain d2hunb_: 2hun B: [165285]
automated match to d1r66a_
complexed with nad
Details for d2hunb_
PDB Entry: 2hun (more details), 2.07 Å
PDB Description: Crystal structure of hypothetical protein PH0414 from Pyrococcus horikoshii OT3
PDB Compounds: (B:) 336aa long hypothetical dTDP-glucose 4,6-dehydrataseSCOPe Domain Sequences for d2hunb_:
Sequence; same for both SEQRES and ATOM records: (download)
>d2hunb_ c.2.1.0 (B:) automated matches {Pyrococcus horikoshii OT3 [TaxId: 70601]}
mhsmkllvtggmgfigsnfiryilekhpdwevinidklgygsnpanlkdleddprytfvk
gdvadyelvkelvrkvdgvvhlaaeshvdrsisspeiflhsnvigtytllesirrenpev
rfvhvstdevygdilkgsftendrlmpsspysatkaasdmlvlgwtrtynlnasitrctn
nygpyqfpeklipktiiraslglkipiygtgknvrdwlyvedhvraielvllkgesreiy
nisageektnlevvkiilrlmgkgeelielvedrpghdlrysldswkitrdlkwrpkytf
degikktidwylknewwwkplvder
SCOPe Domain Coordinates for d2hunb_:
Click to download the PDB-style file with coordinates for d2hunb_.
(The format of our PDB-style files is described here.)
(The format of our PDB-style files is described here.)
Timeline for d2hunb_:
- d2hunb_ first appeared in SCOPe 2.01
- d2hunb_ appears in SCOPe 2.07
View in 3D
