Lineage for d2hhma_ (2hhm A:)
- Root: SCOPe 2.08
Class e: Multi-domain proteins (alpha and beta) [56572] (74 folds) 
Fold e.7: Carbohydrate phosphatase [56654] (1 superfamily)
N-terminal domain is an alpha+beta, C-terminal domain is an alpha/beta with mixed beta-sheetSuperfamily e.7.1: Carbohydrate phosphatase [56655] (3 families) 
Family e.7.1.1: Inositol monophosphatase/fructose-1,6-bisphosphatase-like [56656] (7 proteins) 
Protein Inositol monophosphatase [56663] (1 species) Species Human (Homo sapiens) [TaxId:9606] [56664] (11 PDB entries) 
Domain d2hhma_: 2hhm A: [42955]
complexed with gd, so4
Details for d2hhma_
PDB Entry: 2hhm (more details), 2.1 Å
PDB Description: structure of inositol monophosphatase, the putative target of lithium therapy
PDB Compounds: (A:) inositol monophosphataseSCOPe Domain Sequences for d2hhma_:
Sequence; same for both SEQRES and ATOM records: (download)
>d2hhma_ e.7.1.1 (A:) Inositol monophosphatase {Human (Homo sapiens) [TaxId: 9606]}
wqecmdyavtlarqagevvceaiknemnvmlksspvdlvtatdqkvekmlissikekyps
hsfigeesvaageksiltdnptwiidpidgttnfvhrfpfvavsigfavnkkiefgvvys
cvegkmytarkgkgafcngqklqvsqqeditksllvtelgssrtpetvrmvlsnmeklfc
ipvhgirsvgtaavnmclvatggadayyemgihcwdvagagiivteaggvlmdvtggpfd
lmsrrviaannrilaeriakeiqviplqrdde
SCOPe Domain Coordinates for d2hhma_:
Click to download the PDB-style file with coordinates for d2hhma_.
(The format of our PDB-style files is described here.)
(The format of our PDB-style files is described here.)
Timeline for d2hhma_:
- d2hhma_ first appeared (with stable ids) in SCOP 1.55
- d2hhma_ appears in SCOPe 2.07
View in 3D
