Lineage for d2heka1 (2hek A:1-369)
- Root: SCOPe 2.07
Class a: All alpha proteins [46456] (289 folds) 
Fold a.211: HD-domain/PDEase-like [109603] (1 superfamily)
multihelical; consists of two different alpha-helical bundlesSuperfamily a.211.1: HD-domain/PDEase-like [109604] (6 families) 
Family a.211.1.1: HD domain [101340] (14 proteins)
Pfam PF01966; metal dependent phosphohydrolases
Protein Hypothetical protein aq_1910 [140765] (1 species)
elaborated with additional structures in C-terminal extensionSpecies Aquifex aeolicus [TaxId:63363] [140766] (1 PDB entry)
Uniprot O67745 1-369
Domain d2heka1: 2hek A:1-369 [136354]
Other proteins in same PDB: d2hekb_
complexed with br, cl, gdp, gol, po4, zn
Details for d2heka1
PDB Entry: 2hek (more details), 2 Å
PDB Description: crystal structure of o67745, a hypothetical protein from aquifex aeolicus at 2.0 a resolution.
PDB Compounds: (A:) hypothetical proteinSCOPe Domain Sequences for d2heka1:
Sequence; same for both SEQRES and ATOM records: (download)
>d2heka1 a.211.1.1 (A:1-369) Hypothetical protein aq_1910 {Aquifex aeolicus [TaxId: 63363]}
mikefsdplygfvrvgeaglrlidsfpfqrlryvkqlglaylvfpsaqhtrfehslgvyh
itericeslkvkekelvklagllhdlghppfshttevllprershedfterviketeiye
ilkqdyshedierlvritlgkpedeeekllseiitgefgsdrmdylrrdayfcgvsygff
dydrlistlrvyenkvvvdesglralenflisryfmyvqvyfhkvvrilsihlveflkkl
isqedftdinnflrlndafviselfkrkafredferifqrkhfktllstenyekfsetke
rllekfpqekvrfdevekevyggniyvlsseglkkahelspliaslkpiklyriyvdrql
wekarselk
SCOPe Domain Coordinates for d2heka1:
Click to download the PDB-style file with coordinates for d2heka1.
(The format of our PDB-style files is described here.)
(The format of our PDB-style files is described here.)
Timeline for d2heka1:
- d2heka1 first appeared in SCOP 1.73
- d2heka1 appears in SCOPe 2.06
- d2heka1 appears in the current release, SCOPe 2.08
View in 3D
