Lineage for d2hd1a1 (2hd1 A:181-506)
- Root: SCOP 1.75
Class a: All alpha proteins [46456] (284 folds) 
Fold a.211: HD-domain/PDEase-like [109603] (1 superfamily)
multihelical; consists of two different alpha-helical bundlesSuperfamily a.211.1: HD-domain/PDEase-like [109604] (5 families) 
Family a.211.1.2: PDEase [48548] (6 proteins)
Pfam PF00233; multihelical; can be divided into three subdomains
Protein High-affinity cGMP-specific 3',5'-cyclic phosphodiesterase 9A, PDE9A [109942] (1 species) Species Human (Homo sapiens) [TaxId:9606] [109943] (7 PDB entries)
Uniprot O76083 241-566
Domain d2hd1a1: 2hd1 A:181-506 [136338]
automatically matched to d1tbma_
complexed with ibm, mg, zn
Details for d2hd1a1
PDB Entry: 2hd1 (more details), 2.23 Å
PDB Description: Crystal structure of PDE9 in complex with IBMX
PDB Compounds: (A:) Phosphodiesterase 9ASCOP Domain Sequences for d2hd1a1:
Sequence; same for both SEQRES and ATOM records: (download)
>d2hd1a1 a.211.1.2 (A:181-506) High-affinity cGMP-specific 3',5'-cyclic phosphodiesterase 9A, PDE9A {Human (Homo sapiens) [TaxId: 9606]}
ptypkyllspetiealrkptfdvwlwepnemlsclehmyhdlglvrdfsinpvtlrrwlf
cvhdnyrnnpfhnfrhcfcvaqmmysmvwlcslqekfsqtdililmtaaichdldhpgyn
ntyqinartelavryndisplenhhcavafqilaepecnifsnippdgfkqirqgmitli
latdmarhaeimdsfkekmenfdysneehmtllkmilikccdisnevrpmevaepwvdcl
leeyfmqsdrekseglpvapfmdrdkvtkataqigfikfvlipmfetvtklfpmveeiml
qplwesrdryeelkriddamkelqkk
SCOP Domain Coordinates for d2hd1a1:
Click to download the PDB-style file with coordinates for d2hd1a1.
(The format of our PDB-style files is described here.)
(The format of our PDB-style files is described here.)
Timeline for d2hd1a1:
- d2hd1a1 first appeared in SCOP 1.73
- d2hd1a1 is called d2hd1a_ in SCOPe 2.01
- d2hd1a1 appears in the current release, SCOPe 2.08, called d2hd1a_
View in 3D
